IL-2R beta/CD122 Protein, Mouse (HEK293, His)

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (K_d: 1 nM approximately)^[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells^[2]. IL-2R beta/CD122 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R beta with a C-Terminal 6*His tag, which is produced in HEK 293.

IL-2R beta (CD122) is a type I cytokine receptor, and belongs to Type 4 subfamily. IL-2R beta is also a key component of the IL-15 receptor. IL-2R beta is broadly expressed in spleen, blood, and lymph node, such as B and T lymphocytes^[1][3].
The sequence of amino acids in IL-2R beta differs in different species. Mouse IL-2R beta shares 81.01% aa sequence identity with rats. Human IL-2R beta shares <60% aa sequence identity with mouse and rats.
IL-2R beta cytoplasmic domain heterodimerizes with IL-2 and leads to the activation of signaling pathways: phosphoinositol 3-kinase (PI3-K)/AKT, Ras-MAP kinase, and the JAK-STAT pathways^[4]. IL-2R beta binds IL-2 with intermediate affinity. IL-2R beta mediates IL-2 internalization and signal transduction, such as cell proliferation or differentiation^[5]. IL-2R beta interacts with IL-2 and increases the proportion of CD4+ T lymphocytes^[1]. IL-2R stimulates T cell proliferation and activating lymphokine-activated killer cells^[2].
IL-2R beta mediates T cell immune responses, and also mediates endocytosis, as well as transducing the mitogenic signals of IL-2.

Mouse

HEK293

C-6*His

P16297 (A27-E240)

16185  [NCBI]

Extracellular Domain

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

40-60 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, 4% mannitol, 0.05% Tween 80, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Xiujuan Zhou, et al. Interleukin-2 (IL-2) Interacts With IL-2 Receptor Beta (IL-2Rβ): Its Potential to Enhance the Proliferation of CD4+ T Lymphocytes in Flounder ( Paralichthys olivaceus). Front Immunol. 2020 Sep 9;11:531789.  [Content Brief]

  [2]. R N Bamfordm, et al. The interleukin (IL) 2 receptor beta chain is shared by IL-2 and a cytokine, provisionally designated IL-T, that stimulates T-cell proliferation and the induction of lymphokine-activated killer cells. Proc Natl Acad Sci U S A.1995 May  [Content Brief]

  [3]. Xiujuan Zhou, et al. Immunological characteristics of Interleukin-2 receptor subunit beta (IL-2Rβ) in flounder (Paralichtlys olivaceus): Implication for IL-2R function. Fish Shellfish Immunol. 2019 Oct;93:641-652.  [Content Brief]

  [4]. Akira Sakai, et al. The role of tumor-associated macrophages on serum soluble IL-2R levels in B-cell lymphomas. J Clin Exp Hematop. 2014;54(1):49-58.  [Content Brief]

  [5]. M Allouche, et al. Interleukin 2 receptors. Leuk Res. 1990;14(8):699-704.  [Content Brief]