1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 alpha
  6. IL-36 alpha/IL-1F6 Protein, Human (153a.a)

IL-36 alpha/IL-1F6 Protein, Human (153a.a)

Cat. No.: HY-P70702
COA Handling Instructions

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP. IL-36 alpha/IL-1F6 Protein, Human (153a.a) is a recombinant human IL-36 alpha (K6-F158) without any tag, which is produced in E. coli.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2]. IL-36 alpha/IL-1F6 Protein, Human (153a.a) is a recombinant human IL-36 alpha (K6-F158) without any tag, which is produced in E. coli.

Background

IL-36 alpha, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha is expressed in monocytes, T/B-lymphocytes, spleen, bone-marrow tonsils, lymph nodes and skin[2]. IL-36 alpha is up-regulated in injured kidney. IL-36 alpha is associated with the development of renal pathologies, as well as hepatocellular carcinoma, and some inflammatory/immune diseases including colitis and psoriasis[3].
The sequence of amino acids in IL-36 alpha differs in different species. Human IL-36 alpha shares <55% aa sequence identity with mouse.
IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, thereby mediating inflammatory response. But the activation requires N-terminal cleavage by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[1]. IL-36 alpha can also bind IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2].
IL-36 alpha is a pro-inflammatory factor. IL-36 alpha mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[1].

In Vitro

IL-36 alpha (human) (10 ng/mL, 48 h) stimulates the production of TNF-α and IL-1β in HCECs[4].
IL-36 alpha (human) (500 ng/mL, 48 h) induces maturation of human MDDCs[5].
IL-36 alpha (human) inhibits proliferation, migration, and invasion of both OV2008 and SKOV-3 cells[6].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9UHA7 (K6-F158)

Gene ID
Synonyms
IL-36 alpha; IL-36α; Interleukin-36 Alpha; FIL1 Epsilon; Interleukin-1 Epsilon; IL-1 Epsilon; Interleukin-1 Family Member 6; IL-1F6; IL36A; FIL1E; IL1E; IL1F6
AA Sequence

KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 0.02% Tween 20, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

IL-36 alpha/IL-1F6 Protein, Human (153a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 alpha/IL-1F6 Protein, Human (153a.a)
Cat. No.:
HY-P70702
Quantity:
MCE Japan Authorized Agent: