IL-4 Protein, Mouse (Q136D, Y139D, sf9, His)

Customer Review

Based on 1 Customer Validation

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23. IL-4 Protein, Mouse (Q136D, Y139D, sf9, His) is the recombinant mouse-derived IL-4 protein, expressed by Sf9 insect cells , with C-His labeled tag and Q136D, Y139D mutation.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23. IL-4 Protein, Mouse (Q136D, Y139D, sf9, His) is the recombinant mouse-derived IL-4 protein, expressed by Sf9 insect cells , with C-His labeled tag and Q136D, Y139D mutation.

Background

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 gene encodes two distinct isoforms through alternatively spliced transcription.
IL-4 is a ligand for interleukin 4 receptor (IL4R). IL4R also binds to IL-13, which may contribute to many overlapping functions of IL-4 and IL-13. Upon binding to IL4, IL4R receptor dimerizes either with the common IL2R gamma chain (IL2RG) to produce the type 1 signaling complex, located mainly on hematopoietic cells, or with the IL13RA1 to produce the type 2 complex, which is expressed also on nonhematopoietic cells. Engagement of both types of receptors initiates JAK3 and to a lower extend JAK1 phosphorylation leading to activation of the signal transducer and activator of transcription 6 (STAT6).
IL4 is considered an important cytokine for tissue repair, counterbalancing the effects of proinflammatory type 1 cytokines, IL-4 also promotes allergic airway inflammation. Moreover, IL-4, a type 2 cytokine, mediates and regulates a variety of human host responses such as allergic, anti-parasitic, wound healing, and acute inflammation. IL-4 induces the expression of class II MHC molecules on resting B-cells, enhances both secretion and cell surface expression of IgE and IgG1 and regulates the expression of low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. IL-4 has been reported to promote resolution of neutrophil-mediated acute lung injury as well as positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. In addition, IL-4 plays a critical role in higher functions of the normal brain, such as memory and learning.
IL-4 is implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple)[1][2][3][4][5][6].

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized IL-4 Protein, Mouse (sf9, Q136D, Y139D, His) at 10 μg/mL (100 μl/well) can bind rat IL4R-Fc and the EC50 is 0.12-0.29 μg/mL.
2. Measured by its ability to inhibit mIL4-dependent proliferation of HT-2 cells and the ED50 is typically 2-10 ng/mL in the presence of 2 ng/mL mouse IL4.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-4 (H21-S14, Q136D, Y139D)
      Accession # P7750
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1

  • AA Sequence

    HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMDMDDS

  • Predicted Molecular Mass

    14.9 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 8.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00