1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-4
  5. IL-4 Protein, Mouse (Q136D, Y139D, sf9, His)

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23. IL-4 Protein, Mouse (Q136D, Y139D, sf9, His) is the recombinant mouse-derived IL-4 protein, expressed by Sf9 insect cells , with C-His labeled tag and Q136D, Y139D, , , mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23. IL-4 Protein, Mouse (Q136D, Y139D, sf9, His) is the recombinant mouse-derived IL-4 protein, expressed by Sf9 insect cells , with C-His labeled tag and Q136D, Y139D, , , mutation.

Background

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses. IL-4 gene encodes two distinct isoforms through alternatively spliced transcription.
IL-4 is a ligand for interleukin 4 receptor (IL4R). IL4R also binds to IL-13, which may contribute to many overlapping functions of IL-4 and IL-13. Upon binding to IL4, IL4R receptor dimerizes either with the common IL2R gamma chain (IL2RG) to produce the type 1 signaling complex, located mainly on hematopoietic cells, or with the IL13RA1 to produce the type 2 complex, which is expressed also on nonhematopoietic cells. Engagement of both types of receptors initiates JAK3 and to a lower extend JAK1 phosphorylation leading to activation of the signal transducer and activator of transcription 6 (STAT6).
IL4 is considered an important cytokine for tissue repair, counterbalancing the effects of proinflammatory type 1 cytokines, IL-4 also promotes allergic airway inflammation. Moreover, IL-4, a type 2 cytokine, mediates and regulates a variety of human host responses such as allergic, anti-parasitic, wound healing, and acute inflammation. IL-4 induces the expression of class II MHC molecules on resting B-cells, enhances both secretion and cell surface expression of IgE and IgG1 and regulates the expression of low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. IL-4 has been reported to promote resolution of neutrophil-mediated acute lung injury as well as positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. In addition, IL-4 plays a critical role in higher functions of the normal brain, such as memory and learning.
IL-4 is implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple)[1][2][3][4][5][6].

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized IL-4 Protein, Mouse (sf9, Q136D, Y139D, His) at 10 μg/mL (100 μl/well) can bind rat IL4R-Fc and the EC50 is 0.12-0.29 μg/mL.
2. Measured by its ability to inhibit mIL4-dependent proliferation of HT-2 cells and the ED50 is typically 2-10 ng/mL in the presence of 2 ng/mL mouse IL4.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

P07750 (H21-S140, Q136D, Y139D)

Gene ID
Molecular Construction
N-term
IL-4 (H21-S14, Q136D, Y139D)
Accession # P775
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1
AA Sequence

MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMDMDDS

Molecular Weight

Approximately 19 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 8.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-4 Protein, Mouse (Q136D, Y139D, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-4 Protein, Mouse (Q136D, Y139D, sf9, His)
Cat. No.:
HY-P73215
Quantity:
MCE Japan Authorized Agent: