1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO1/R-spondin-1 Protein, Human (CHO, His)

RSPO1/R-spondin-1 Protein, Human (CHO, His)

Cat. No.: HY-P7114
Handling Instructions

RSPO1/R-spondin-1 Protein, Human is a secreted protein that activates Wnt signaling.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $180 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg $600 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

RSPO1/R-spondin-1 Protein, Human (CHO, His) Featured Recommendations:

Top Publications Citing Use of Products

RSPO1/R-spondin-1 Protein, Human (CHO, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

CHO

Tag

C-His

Accession

Q2MKA7 (S21-A263)

Gene ID

284654

Synonyms
rHuR-spondin-1/RSPO1; Roof plate-specific spondin-1
AA Sequence

RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPAHHHHHH

Molecular Weight

Approximately 38.0 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The R-Spondin (RSpo) family of secreted proteins act as potent activators of the Wnt/ -catenin signaling pathway. R-spondin-1/RSPO1 activity critically depends on the presence of canonical Wnt ligands and LRP6[1]. Although R-spondin-1/RSPO1 does not directly activate LRP6, R-spondin-1/RSPO1 can interfere with DKK1 function, which is to regulate the turnover of the LRP5 or LRP6 receptor and to amplify Wnt-dependent signaling[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO1/R-spondin-1 Protein, Human (CHO, His)
Cat. No.:
HY-P7114
Quantity:
MCE Japan Authorized Agent: