RSPO1/R-spondin-1 Protein, Human (CHO, His)

RSPO1/R-spondin-1 Protein, Human is a secreted protein that activates Wnt signaling.

The R-Spondin (RSpo) family of secreted proteins act as potent activators of the Wnt/ -catenin signaling pathway. R-spondin-1/RSPO1 activity critically depends on the presence of canonical Wnt ligands and LRP6^[1]. Although R-spondin-1/RSPO1 does not directly activate LRP6, R-spondin-1/RSPO1 can interfere with DKK1 function, which is to regulate the turnover of the LRP5 or LRP6 receptor and to amplify Wnt-dependent signaling^[2].

1.R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED₅₀ is 1.182 μg/mL.corresponding to a specific activity is 8.46 ×10² units/mg.
2.Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED₅₀ for this effect is 1-10 ng/mL.

• 
  R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED₅₀ is 1.182 μg/ml.corresponding to a specific activity is  8.46 ×10^2 units/mg.

Human

CHO

C-6*His

Q2MKA7 (S21-A263)

284654  [NCBI]

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

38-42 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH 7.4.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Binnerts ME, et al. R-Spondin1 regulates Wnt signaling by inhibiting internalization of LRP6. Proc Natl Acad Sci U S A. 2007 Sep 11;104(37):14700-5.  [Content Brief]

  [2]. Zhao J, et al. Tipping the balance: modulating the Wnt pathway for tissue repair. Trends Biotechnol. 2009 Mar;27(3):131-6.  [Content Brief]