Copy Link Print Information

RSPO1/R-spondin-1 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1, Human promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (HEK293, His) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293 with a C-His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (HEK293, His)
  • RSPO1/R-spondin-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1, Human promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (HEK293, His) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293 with a C-His tag.

Background

RSPO1/R-spondin-1 belongs to the R-spondin family (including 4 members, RSPO 1-4)[2][4]. RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligase, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription[2][4][7]. RSPO1/R-spondin-1 is expressed in intestinal epithelium, pancreatic acini, bone mesenchyme, joint osteoblasts and other tissues[1][5][6][7]. RSPO1/R-spondin-1, Human is highly homologous to RSPO1 in mouse, rat and other species in terms of amino acid sequence and function (such as activating Wnt signaling and promoting tissue regeneration)[5][6]. RSPO1/R-spondin-1, Human is composed of 263 amino acids, contains N-glycosylation modification (such as Asn137 site), and sugar chain structures include sialic acid, N-acetylglucosamine, etc.[4]. RSPO1/R-spondin-1, Human promotes the survival of intestinal organoids, induces pancreatic β-cell proliferation to improve diabetes, enhances the osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models[2][5][6][7].

In Vitro

RSPO1/R-spondin-1, Human (500 ng/mL) increases size and survival in mouse intestinal organoid unit (OU) culture and activates the Wnt/β-catenin pathway[2].
RSPO1/R-spondin-1, Human (1 μg/mL) induces expansion of human pancreatic organoids (hPOs) and maintains a ductal cell phenotype[3].
RSPO1/R-spondin-1, Human (400 nM; 24 h) promotes proliferation of pancreatic β cells in MIN6 mice in a dose-dependent manner[5].
RSPO1/R-spondin-1, Human (100 ng/mL) enhances Wnt signaling (β-catenin nuclear accumulation) and induces alkaline phosphatase and osteoprotegerin (OPG) expression in mouse C2C12 mesenchymal cells and primary osteoblasts[7].

In Vivo

RSPO1/R-spondin-1, Human (0.8 mg/kg; i.p.; 80 days) maintains normoglycemia and improves glucose tolerance in Streptozotocin (HY-13753)-induced diabetic mice[5].
RSPO1/R-spondin-1, Human (3.3 μg/g; i.p.; daily; 7 days) increases bone mineralization deposition rate and promotes osteoblast differentiation in aging model mice (Terc-/-, Wrn-/-Terc-/-)[6].

Verified Bioactivity

1.R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 0.5-3 μg/mL.
2.Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 1-10 ng/mL

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 2.232 μg/mL.corresponding to a specific activity is 4.48×10^2 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q2MKA7-1 (S21-A263)

  • Gene ID
    284654  [NCBI]
  • Molecular Construction
    • N-term
    • RSPO1 (S21-A263)
      Accession # Q2MKA7-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    RSPO1; R-Spondin Homolog (Xenopus Laevis); R-Spondin 1; R-Spondin Homolog; Roof Plate-Specific Spondin-1; CRISTIN3; R-Spondin-1; HRspo1; FLJ40906; RSPO; RSPONDIN

  • AA Sequence

    SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

  • Predicted Molecular Mass

    27.8 kDa

  • Molecular Weight

    Approximately 38-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
3.Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, 4% Mannitol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Qu M, et al. Establishment of intestinal organoid cultures modeling injury-associated epithelial regeneration. Cell Res. 2021 Mar;31(3):259-271. [Content Brief]

[2]. Levin G, et al. R-Spondin 1 (RSPO1) Increases Mouse Intestinal Organoid Unit Size and Survival in vitro and Improves Tissue-Engineered Small Intestine Formation in vivo. Front Bioeng Biotechnol. 2020 Jun 5;8:476. [Content Brief]

[3]. Dossena M, et al. Standardized GMP-compliant scalable production of human pancreas organoids. Stem Cell Res Ther. 2020 Mar 4;11(1):94. [Content Brief]

[4]. Levin G, et al. Production, purification and characterization of recombinant human R-spondin1 (RSPO1) protein stably expressed in human HEK293 cells. BMC Biotechnol. 2020 Jan 20;20(1):5. [Content Brief]

[5]. Silvano S, et al. RSPO1, a potent inducer of pancreatic β cell neogenesis. Cell Rep Med. 2025 May 20;6(5):102126. [Content Brief]

[6]. Wang H, et al. R-Spondin 1 promotes vibration-induced bone formation in mouse models of osteoporosis. J Mol Med (Berl). 2013 Dec;91(12):1421-9. [Content Brief]

[7]. Krönke G, et al. R-spondin 1 protects against inflammatory bone damage during murine arthritis by modulating the Wnt pathway. Arthritis Rheum. 2010 Aug;62(8):2303-12. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 2.232 μg/mL.corresponding to a specific activity is 4.48×10^2 units/mg.

  • RSPO1/R-spondin-1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (HEK293, His)
  • RSPO1/R-spondin-1 Protein, Human (HEK293, His) Product Image