1. Recombinant Proteins
  2. Others
  3. STUB1 Protein, Human

STUB1 Protein, Human

Cat. No.: HY-P71340
COA Handling Instructions

STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90). STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free. The total length of STUB1 Protein, Human is 303 a.a., with molecular weight of ~33.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $108 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90). STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free. The total length of STUB1 Protein, Human is 303 a.a., with molecular weight of ~33.0 kDa.

Background

STUB1 Protein, an E3 ubiquitin-protein ligase, plays a pivotal role in targeting misfolded chaperone substrates for proteasomal degradation, collaborating with ATXN3 to regulate the ubiquitin chain length attached to STUB1 substrates and prevent further chain extension. It ubiquitinates NOS1 in conjunction with Hsp70 and Hsp40, modulating the activity of key chaperone complexes such as Hsp70, Hsc70, and Hsp90. Additionally, STUB1 mediates the transfer of non-canonical short ubiquitin chains to HSPA8 without affecting its degradation. The protein is involved in base-excision repair by catalyzing polyubiquitination of DNA polymerase beta (POLB), amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB degradation. STUB1 also participates in the polyubiquitination of CYP3A4, ubiquitinates EPHA2 to potentially regulate receptor stability, acts as a co-chaperone for HSPA1A and HSPA1B, and negatively regulates TGF-beta signaling by modulating SMAD3 levels via ubiquitin-mediated degradation. Furthermore, STUB1 contributes to the degradation of FOXP3, SIRT6, and RIPK3, and likely downregulates PD-L1/CD274 plasma membrane expression. Its diverse functions underscore its significance in cellular homeostasis and immune regulation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9UNE7 (M1-Y303)

Gene ID
Molecular Construction
N-term
STUB1 (M1-Y303)
Accession # Q9UNE7
C-term
Synonyms
E3 Ubiquitin-Protein Ligase CHIP; Antigen NY-CO-7; CLL-Associated Antigen KW-8; Carboxy Terminus of Hsp70-Interacting Protein; STIP1 Homology and U Box-Containing Protein 1; STUB1; CHIP
AA Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Molecular Weight

Approximately 33.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

STUB1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
STUB1 Protein, Human
Cat. No.:
HY-P71340
Quantity:
MCE Japan Authorized Agent: