Search Result

Results for "

mimicking

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Bcl-2 Family (1) Calcium Channel (1) Endogenous Metabolite (1) iGluR (3) Liposome (1) Melanocortin Receptor (2) Sodium Channel (1) Thrombin (1) VEGFR (1) Wnt (2)
By Research Areas:	Cancer (5) Inflammation/Immunology (1) Neurological Disease (4)

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

Natural
Products

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P5558

KLTWQELYQLKYKGI	VEGFR	Inflammation/Immunology
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .

HY-P1416A

Foxy-5 TFA 3 Publications Verification	Wnt	Cancer
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-112416

AZD4320 1 Publications Verification	Bcl-2 Family	Cancer
AZD4320 is a novel BH3-mimicking dual BCL2/BCLxL inhibitor with IC₅₀s of 26 nM, 17 nM, and 170 nM for KPUM-MS3, KPUM-UH1, and STR-428 cells, respectively.

HY-P1416

Foxy-5	Wnt	Cancer
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P0102

Dipeptide diaminobutyroyl benzylamide diacetate
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .

HY-17551

NMDA Maximum Cited Publications 12 Publications Verification N-Methyl-D-aspartic acid	iGluR Endogenous Metabolite	Neurological Disease
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.

HY-W142596

1,2-DImyristoyl-rac-glycero-3-phosphocholine	Liposome	Others
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .

HY-B0867

2,4-D Butyl ester
2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .

HY-P5371

TFLLRNPNDK-NH2	Thrombin	Others
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)

HY-N2466A

Melanotan I acetate MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate	Melanocortin Receptor	Cancer
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-N2466

Melanotan I 1 Publications Verification MT-I; [Nle4,D-Phe7]-α-MSH	Melanocortin Receptor	Neurological Disease Cancer
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-131614

TPC2-A1-N 2 Publications Verification	Calcium Channel	Others
TPC2-A1-N is a powerful and Ca ²⁺-permeable agonist of two pore channel 2 (TPC2), which plays its role by mimicking the physiological actions of NAADP. TPC2-A1-P reproducibly evokes significant Ca ²⁺ responses from TPC2 (EC₅₀=7.8 μM), and the effect can be blocked by several TPC blockers. TPC2-A1-N can be used to probe different functions of TPC2 channels in intact cells .

HY-131615

TPC2-A1-P 1 Publications Verification	Sodium Channel	Others
TPC2-A1-P is a powerful and membrane permeable agonist of two pore channel 2 (TPC2) with an EC₅₀ of 10.5 μM. TPC2-A1-P plays its role by mimicking the physiological actions of PI(3,5)P2. TPC2-A1-P also shows higher potency to induce Na ²⁺ mobilisation from TPC2 than TPC-A1-N (HY-131614). TPC2-A1-P can be used to probe different functions of TPC2 channels in intact cells .

1,2-DImyristoyl-rac-glycero-3-phosphocholine	Drug Delivery
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .

Cat. No.	Product Name	Target	Research Area

HY-P5558

KLTWQELYQLKYKGI	VEGFR	Inflammation/Immunology
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .

HY-P1416A

Foxy-5 TFA 3 Publications Verification	Wnt	Cancer
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P1416

Foxy-5	Wnt	Cancer
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P5371

TFLLRNPNDK-NH2	Thrombin	Others
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)

HY-N2466A

Melanotan I acetate MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate	Melanocortin Receptor	Cancer
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-N2466

Melanotan I 1 Publications Verification MT-I; [Nle4,D-Phe7]-α-MSH	Melanocortin Receptor	Neurological Disease Cancer
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

NMDA 10+ Cited Publications N-Methyl-D-aspartic acid	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	iGluR Endogenous Metabolite
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Name
Email *

	Sorry, but the email address you supplied was invalid.

mimicking

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

NaturalProducts

Natural
Products