2. GPCR/G Protein
  3. GCGR
  4. Exendin-4

Exendin-4  (Synonyms: Exenatide)

Cat. No.: HY-13443 Purity: 99.94%
COA Handling Instructions

Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Exendin-4 Chemical Structure

Exendin-4 Chemical Structure

CAS No. : 141758-74-9

Size Price Stock Quantity
1 mg USD 72 In-stock
5 mg USD 168 In-stock
10 mg USD 252 In-stock
25 mg USD 360 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 33 publication(s) in Google Scholar

Other Forms of Exendin-4:

Exendin-4 Related Antibodies

Top Publications Citing Use of Products

31 Publications Citing Use of MCE Exendin-4

Proliferation Assay
RT-PCR

    Exendin-4 purchased from MCE. Usage Cited in: Front Pharmacol. 2019 Oct 25;10:1230.  [Abstract]

    Exendin-4 or FSK treatment reduces ER stress-induced β-cell viability. INS-1 cells are incubated with THAP (0.5 μM), with Eexendin-4.

    Exendin-4 purchased from MCE. Usage Cited in: Front Pharmacol. 2019 Oct 25;10:1230.  [Abstract]

    INS-1 cells are incubated with THAP (0.5 μM), H89, with Exendin-4 or FSK at indicated concentration for 24 h, then the IL-1β level is analyzed by qRT-PCR (n = 3).

    • Biological Activity

    • Protocol

    • Purity & Documentation

    • References

    • Customer Review

    Description

    Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.

    IC50 & Target

    IC50: 3.22 nM (glucagon-like peptide-1 receptor)[1]
    In Vitro

    In human umbilical vein endothelial cells, exendin-4 significantly increases NO production, endothelial NO synthase (eNOS) phosphorylation, and GTP cyclohydrolase 1 (GTPCH1) level in a dose-dependent manner[2]. Exendin-4 shows cytotoxic effects to MCF-7 breast cancer cells with IC50 of 5 μM at 48 hour[3].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.

    Exendin-4 Related Antibodies
    In Vivo

    Both low- and high-dose exendin-4 treatment in ob/ob mice improve serum ALT and reduce serum glucose, and calculated HOMA scores compared with control. Exendin-4-treated ob/ob mice sustain a marked reduction in the net weight gain in the final 4 weeks of the study period[4]. Animals treated with exendin-4 have more pancreatic acinar inflammation, more pyknotic nuclei and weigh significantly less than control rats. Exendin-4 treatment is associated with lower leptin levels as well as lower HOMA values in rats[5]. Exenatide causes dose-dependent relaxation of rat thoracic aorta, which is evoked via the GLP-1 receptor and is mediated mainly by H2S but also by NO and CO[6].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.
    Clinical Trial
    Molecular Weight

    4186.57

    Appearance

    Solid

    Formula

    C184H282N50O60S
    CAS No.
    Sequence

    His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
    Sequence Shortening

    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
    Shipping

    Room temperature in continental US; may vary elsewhere.
    Storage

    Sealed storage, away from moisture and light, under nitrogen

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
    Solvent & Solubility
    In Vitro: 

    H2O : 33.33 mg/mL (7.96 mM; Need ultrasonic)

    DMSO : ≥ 32 mg/mL (7.64 mM)

    Ethanol : < 1 mg/mL (ultrasonic;warming;heat to 60°C) (insoluble)

    *"≥" means soluble, but saturation unknown.

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2389 mL 1.1943 mL 2.3886 mL
    5 mM 0.0478 mL 0.2389 mL 0.4777 mL
    10 mM --- --- ---
    *Please refer to the solubility information to select the appropriate solvent.
    In Vivo:
    • 1.

      Add each solvent one by one:  PBS

      Solubility: 100 mg/mL (23.89 mM); Clear solution; Need ultrasonic and warming and heat to 60°C

    • 2.

      Add each solvent one by one:  10% DMSO    40% PEG300    5% Tween-80    45% saline

      Solubility: ≥ 2.5 mg/mL (0.60 mM); Clear solution

    • 3.

      Add each solvent one by one:  10% DMSO    90% (20% SBE-β-CD in saline)

      Solubility: ≥ 2.5 mg/mL (0.60 mM); Clear solution

    • 4.

      Add each solvent one by one:  10% DMSO    90% corn oil

      Solubility: ≥ 2.5 mg/mL (0.60 mM); Clear solution

    *All of the co-solvents are available by MCE.
    Purity & Documentation

    Purity: 99.94%

    COA (242 KB) LCMS (86 KB) Elemental Analysis Report (100 KB)

    Handling Instructions (2659 KB)
    References
    Animal Administration
    [4][5]

    Rats: 20 Sprague-Dawley male rats, ten of which are treated with exendin-4 (10 μg/kg) and ten of which are used as controls. The study period is 75 days. Serum and pancreatic tissue are removed for biochemical and histological study. Blood glucose, amylase, lipase and adipocytokines are compared between the two groups[5].

    Mice: The exendin-4 treatment groups are treated with 10 μg/kg every 24 hours for the first 14 days. This treatment is the induction phase. Respective control mice (lean and ob/ob) receive saline every 24 hours. After 14 days Exendin-4-treated mice are randomly divided into two groups: one group receives high dose exendin-4 (20 μg/kg) every 12 hours, while the second group continues with low dose exendin-4 (10 μg/kg) every 12 hours. The control mice continue to receive saline every 12 hours. The mice are weighed daily for the 60-day treatment period[4].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.
    References
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    Exendin-4 Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Molarity Calculator

    • Dilution Calculator

    The molarity calculator equation

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass   Concentration   Volume   Molecular Weight *
    = × ×

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    Keywords:

    Exendin-4141758-74-9ExenatideExendin4Exendin 4GCGRGlucagon ReceptorInhibitorinhibitorinhibit

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Salutation

    Applicant Name *

    		 

    Email address *

    Phone number *

    		 

    Organization name *

    Department *

    		 

    Requested quantity *

    Country or Region *

    		      

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Exendin-4
    Cat. No.:
    HY-13443
    Quantity:
    MCE Japan Authorized Agent:

    Customer Review

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Lot #

    Applicant Name *

    		 

    Email address *

    Phone number

    		 

    Department *

    Organization name *

    		 

    Country or Region *

    Remarks

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.