1. GPCR/G Protein
  2. Glucagon Receptor

Exendin-4 (Synonyms: Exenatide; His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2; HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2)

Cat. No.: HY-13443 Purity: 98.96%
Data Sheet SDS Handling Instructions

Exendin-4, a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.

For research use only. We do not sell to patients.
Exendin-4 Chemical Structure

Exendin-4 Chemical Structure

CAS No. : 141758-74-9

Size Price Stock Quantity
10 mM * 1 mL in DMSO USD 663 In-stock
1 mg USD 72 In-stock
5 mg USD 168 In-stock
10 mg USD 252 In-stock
25 mg USD 360 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Other Forms of Exendin-4:

    Exendin-4 purchased from MCE. Usage Cited in: Sci Rep. 2017 Jun 28;7(1):4351.

    Western blot analysis of CREB protein phosphorylation in pancreas of KKAy mice treated with HBK001 and Linagliptin.

    Exendin-4 purchased from MCE. Usage Cited in: Acta Biochim Biophys Sin (Shanghai). 2017 May 5:1-8.

    PANC-1 cells treated with different concentrations of combination of CHIR99021 and ESI-09 (0, 1 μM+1 μM, 3 μM+3 μM, 5 μM+5 μM, and 10 μM+10 μM) for 48 h.
    • Biological Activity

    • Protocol

    • Technical Information

    • Purity & Documentation

    • References


    Exendin-4, a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.

    IC50 & Target

    IC50: 3.22 nM (glucagon-like peptide-1 receptor)[1]

    In Vitro

    In human umbilical vein endothelial cells, exendin-4 significantly increases NO production, endothelial NO synthase (eNOS) phosphorylation, and GTP cyclohydrolase 1 (GTPCH1) level in a dose-dependent manner[2]. Exendin-4 shows cytotoxic effects to MCF-7 breast cancer cells with IC50 of 5 μM at 48 hour[3].

    In Vivo

    Both low- and high-dose exendin-4 treatment in ob/ob mice improve serum ALT and reduce serum glucose, insulin levels and calculated HOMA scores compared with control. Exendin-4-treated ob/ob mice sustain a marked reduction in the net weight gain in the final 4 weeks of the study period[4]. Animals treated with exendin-4 have more pancreatic acinar inflammation, more pyknotic nuclei and weigh significantly less than control rats. Exendin-4 treatment is associated with lower insulin and leptin levels as well as lower HOMA values in rats[5]. Exenatide causes dose-dependent relaxation of rat thoracic aorta, which is evoked via the GLP-1 receptor and is mediated mainly by H2S but also by NO and CO[6].

    Clinical Trial
    View MoreCollapse
    Preparing Stock Solutions
    Concentration Volume Mass 1 mg 5 mg 10 mg
    1 mM 0.2389 mL 1.1943 mL 2.3886 mL
    5 mM 0.0478 mL 0.2389 mL 0.4777 mL
    10 mM 0.0239 mL 0.1194 mL 0.2389 mL
    Please refer to the solubility information to select the appropriate solvent.
    Animal Administration

    Rats: 20 Sprague-Dawley male rats, ten of which are treated with exendin-4 (10 μg/kg) and ten of which are used as controls. The study period is 75 days. Serum and pancreatic tissue are removed for biochemical and histological study. Blood glucose, amylase, lipase, insulin and adipocytokines are compared between the two groups[5].

    Mice: The exendin-4 treatment groups are treated with 10 μg/kg every 24 hours for the first 14 days. This treatment is the induction phase. Respective control mice (lean and ob/ob) receive saline every 24 hours. After 14 days Exendin-4-treated mice are randomly divided into two groups: one group receives high dose exendin-4 (20 μg/kg) every 12 hours, while the second group continues with low dose exendin-4 (10 μg/kg) every 12 hours. The control mice continue to receive saline every 12 hours. The mice are weighed daily for the 60-day treatment period[4].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.

    Molecular Weight




    CAS No.


    Powder -80°C 2 years
      -20°C 1 year
    In solvent -80°C 6 months
      -20°C 1 month

    Room temperature in continental US; may vary elsewhere

    Solvent & Solubility

    DMSO: ≥ 32 mg/mL; H2O: 1.23 mg/mL (Need ultrasonic and warming)

    * "<1 mg/mL" means slightly soluble or insoluble. "≥" means soluble, but saturation unknown.

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product name



    Applicant name *


    Email address *

    Phone number *


    Organization name *

    Country *


    Requested quantity *


    Bulk Inquiry

    Inquiry Information

    Product Name:
    Cat. No.: