Animal-Free MIP-1 alpha/CCL3 Protein, Human (His)

MIP-1 alpha/CCL3 protein, a monokine with inflammatory and chemokinetic properties, binds to CCR1, CCR4, and CCR5 receptors. Produced by CD8+ T-cells, it inhibits various strains of HIV-1, HIV-2, and SIV in a dose-dependent manner. Additionally, MIP-1 alpha/CCL3 self-associates and forms a heterodimer with MIP-1-beta(3-69). Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is the recombinant human-derived animal-FreeMIP-1 alpha/CCL3 protein, expressed by E. coli, with tag free. The total length of Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is 66 a.a., with molecular weight of ~7.43 kDa.

MIP-1 alpha/CCL3 protein, a monokine with inflammatory and chemokinetic properties, exhibits binding affinity to CCR1, CCR4, and CCR5 receptors. This protein, a major HIV-suppressive factor produced by CD8+ T-cells, demonstrates a dose-dependent inhibition of various strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). MIP-1 alpha/CCL3 self-associates and forms a heterodimer with MIP-1-beta(3-69).

The ED₅₀ is <10 ng/mL as measure by its ability to chemoattract BaF3 cells transfected with human CCR5.

Human

E. coli

Tag Free

P10147 (A27-A92)

6348  [NCBI]

ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Approximately 7.43 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.