CDK5 Protein, Human (P.pastoris, His)

CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5 Protein, Human (P.pastoris, His) is the recombinant human-derived CDK5 protein, expressed by P. pastoris , with N-His labeled tag. The total length of CDK5 Protein, Human (P.pastoris, His) is 292 a.a., with molecular weight of ~38.0 kDa.

CDK5, a proline-directed serine/threonine-protein kinase, stands as an essential player in neuronal cell cycle regulation, differentiation, and the potential induction of apoptotic cell death in neuronal diseases by instigating abortive cell cycle re-entry. Its interactions span a spectrum, engaging with proteins like D1 and D3-type G1 cyclins, SRC, NOS3, VIM/vimentin, p35/CDK5R1, MEF2A, SIPA1L1, SH3GLB1, PXN, PAK1, MCAM/MUC18, SEPT5, SYN1, DNM1, AMPH, SYNJ1, CDK16, RAC1, RHOA, CDC42, TONEBP/NFAT5, MAPT/TAU, MAP1B, histone H1, p53/TP53, HDAC1, APEX1, PTK2/FAK1, huntingtin/HTT, ATM, MAP2, NEFH, and NEFM. Functionally, CDK5 orchestrates critical processes in neuronal development, including survival, migration, differentiation, axonal and neurite growth, synaptogenesis, oligodendrocyte differentiation, synaptic plasticity, and neurotransmission, achieved by phosphorylating key proteins. Additionally, it negatively regulates the CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals. In the mature central nervous system, CDK5 plays a pivotal role in neurotransmitter movements and cell survival, activating anti-apoptotic proteins BCL2 and STAT3 while negatively regulating JNK3/MAPK10 activity. Its multifaceted functions encompass the intricate regulation of various cellular processes, including DNA damage response, Wnt/beta-catenin signaling, and the GAIT pathway. Moreover, CDK5 impacts dendritic spine morphogenesis and participates in circadian clock regulation by modulating CLOCK protein function.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

P. pastoris

N-His

Q00535 (M1-P292)

1020  [NCBI]

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Approximately 38.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.