1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, Fc)

Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5/EFNA5 protein is the GPI-binding ligand of Eph receptor and plays a crucial role in neuronal, vascular and epithelial development. It binds to nearby Eph receptors, initiating bidirectional signaling and regulating intercellular adhesion and cytoskeletal organization. Ephrin-A5/EFNA5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Ephrin-A5/EFNA5 protein, a cell surface GPI-bound ligand for Eph receptors, plays a pivotal role in neuronal, vascular, and epithelial development, where Eph receptors are critical for migration, repulsion, and adhesion. EFNA5 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. This protein induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor, a process requiring the activity of the Fyn tyrosine kinase. EFNA5 activates the EPHA3 receptor, regulating cell-cell adhesion and cytoskeletal organization, and, in conjunction with EPHA2, potentially contributes to shaping lens fiber cells and maintaining lens transparency. It may actively stimulate axon fasciculation and mediate communication between pancreatic islet cells, influencing glucose-stimulated insulin secretion. As a cognate ligand for EPHA7, EFNA5 regulates brain development by modulating cell-cell adhesion and repulsion. It binds to the receptor tyrosine kinases EPHA2, EPHA3, and EPHB1 and forms a ternary complex with EPHA3 and ADAM10, mediating EFNA5 extracellular domain shedding by ADAM10, which in turn regulates the internalization and function of the EFNA5-EPHA3 complex. EFNA5 also binds to EPHB2 and interacts with EPHA8, activating the latter receptor.

Biological Activity

Immobilized Mouse EPHA4 at 2 μg/ml (100 μl/well) can bind mouse EFNA5-Fc with a linear range of 1.28-42.2 ng/ml.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O08543 (Q21-N203)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-N203)
Accession # O08543
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Molecular Weight

Approximately 52 kDa

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Ephrin-A5/EFNA5 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Ephrin-A5/EFNA5 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75232
Quantity:
MCE Japan Authorized Agent: