1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Growth Differentiation Factor GDNF family
  5. Growth Differentiation Factor 15 (GDF-15)
  6. GDF-15 Protein, Mouse (Biotinylated, HEK293, Fc)

GDF-15 Protein, Mouse (Biotinylated, HEK293, Fc)

Cat. No.: HY-P77946
COA Handling Instructions

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB). GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ). GDF-15 Protein, Mouse (Biotinylated, HEK293, Fc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $300 In-stock
50 μg $658 In-stock
100 μg $1050 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB). GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ)[1]. GDF-15 Protein, Mouse (Biotinylated, HEK293, Fc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag.

Background

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 was highly expressed in placenta, low in prostate and colon, and to some extent in kidney. So GDF-15 is also known as placental transforming growth factor PGF-β, placental bone morphogenetic protein PLAB, and prostatus-derived factor PDF. GDF-15 has a wide range of biological functions in physiology and pathology, especially in aging, cancer, and metabolic processes. GDF-15 is initially stored in the extracellular matrix (ECM), where it undergoes proteolytic hydrolysis upon external stimulation to form an active form that is quickly secreted into circulation. In mouse cardiomyocytes, the cleavage process of GDF-15 may be catalyzed by the enzymes of the PCSK family, resulting in a mature dimer form. Upstream of the GDF15 promoter site, there are binding sites for various transcription factors, including specific protein 1 (Sp1), early growth response protein 1 (Egr-1), p53 and COUP transcription factor 1 (COUP-TF1). The receptor of GDF-15 is alpha-like protein (GFRAL), a receptor of the glial cell derived neurotrophic factor (GDNF) family. The GFRAL-GDF15 complex binds to the tyrosine kinase co-receptor RET, leading to RET phosphorylation. Subsequently, GFRAL-GDF15 continued to activate the intracellular signaling pathways of AKT, ERK1/2, and phospholipase C (PLCγ), but not the SMAD pathway. GDF-15 is overexpressed during and after many pathological states such as tissue injury and inflammation. The stimulating factors that contribute to this result include oxidized low-density lipoprotein (oxLDL), cytokines, and growth factors such as IL-1β, TNF-α, angiotensin II, macrophage colony-stimulating factor M-CSF, and TGFβ. GDF-15, also known as the NSAIDS drug activator gene NAG-1, may play an anti-inflammatory role by inhibiting macrophage activation. GDF-15 also inhibits the activity of NFκB or the expression of several cytokines, including interferon (IFN-γ), interleukin-6 (IL-6), monocyte chemotactic protein-1 (MCP-1), and tumor necrosis factor-α (TNF-α). GDF-15 has significant resistance to endotoxin-induced sepsis caused by acute kidney injury (AKI) and myocardial dysfunction. GDF-15 also appears to promote tumor growth in the later stages of malignancy. Elevated serum GDF15 levels have been reported as potential biomarkers for cancer progression, including breast, colon, pancreatic, and prostate tumors, among others. In human and cynomolgus monkeys, the amino acid sequence similarity of GDF-15 protein was high, and the similarity rate was 91.56%. Compared with the amino acid sequences of mice and rats, the similarity of human GDF-15 was low (59.73% and 59.39%, respectively)[1].

In Vivo

GDF-15 knockout mice show smaller Platinum-based treatment-induced anorexia and weight loss, while GDF-15 neutralization with the monoclonal antibody mAB1 improves survival[2].

Biological Activity

Immobilized Mouse GFRAL,His Tag at 2 μg/mL (100μl/Well) on the plate. Dose response curve for Bietinylated Mouse GDF15, hFc Tag with the EC50 ≤ 8 ng/mL dletermined by ELISA.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q9Z0J7 (S189-A303)

Gene ID

23886  [NCBI]

Molecular Construction
N-term
hFc
GDF-15 (S189-A303)
Accession # Q9Z0J7
C-term
Synonyms
GDF-15; MIC-1; NAG-1; PDF; PLAB; PTGFB; GDF15; MIC1; RG-1; Placental TGF-beta; PTGF-beta; PTGFBPTGF-beta
AA Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Weight

40-50 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-15 Protein, Mouse (Biotinylated, HEK293, Fc)
Cat. No.:
HY-P77946
Quantity:
MCE Japan Authorized Agent: