1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12 IL-23
  5. IL-12 beta
  6. Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His)

Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His)

Cat. No.: HY-P74874
COA Handling Instructions

IL-23, collaborating with IL12B, constitutes the pro-inflammatory cytokine IL-23, crucial in innate and adaptive immunity. Released by antigen-presenting cells like dendritic cells or macrophages, IL-23 binds to IL12RB1 and IL23R, activating JAK2 and TYK2. This cascade phosphorylates STAT3 and STAT4, activating pathways like p38 MAPK or NF-kappa-B, inducing pro-inflammatory cytokines. IL-23 contributes to intracellular bacterial clearance and supports the expansion of T-helper 17 cells, including IL-17 producers. The disulfide-linked IL-23 interacts with IL12B and IL23R, recruiting IL12RB1. Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His) is a recombinant protein dimer complex containing mouse, human-derived Human IL-23 alpha & Mouse IL-12 beta Heterodimer protein, expressed by HEK293, with C-His, C-6*His labeled tag. Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His), has molecular weight of ~23.18 & 40-50 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $45 In-stock
10 μg $125 In-stock
50 μg $350 In-stock
100 μg $595 In-stock
500 μg $1666 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-23, collaborating with IL12B, constitutes the pro-inflammatory cytokine IL-23, crucial in innate and adaptive immunity. Released by antigen-presenting cells like dendritic cells or macrophages, IL-23 binds to IL12RB1 and IL23R, activating JAK2 and TYK2. This cascade phosphorylates STAT3 and STAT4, activating pathways like p38 MAPK or NF-kappa-B, inducing pro-inflammatory cytokines. IL-23 contributes to intracellular bacterial clearance and supports the expansion of T-helper 17 cells, including IL-17 producers. The disulfide-linked IL-23 interacts with IL12B and IL23R, recruiting IL12RB1. Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His) is a recombinant protein dimer complex containing mouse, human-derived Human IL-23 alpha & Mouse IL-12 beta Heterodimer protein, expressed by HEK293, with C-His, C-6*His labeled tag. Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His), has molecular weight of ~23.18 & 40-50 kDa, respectively.

Background

IL-23, in collaboration with IL12B, forms the pro-inflammatory cytokine IL-23, playing diverse roles in both innate and adaptive immunity. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to a heterodimeric receptor complex comprising IL12RB1 and IL23R, initiating a cascade involving JAK2 and TYK2 activation. These kinases phosphorylate the receptor, creating a docking site for the subsequent phosphorylation of STAT3 and STAT4. This process activates multiple pathways, including p38 MAPK or NF-kappa-B, fostering the production of pro-inflammatory cytokines, such as interleukin-17A/IL17A. Additionally, IL-23 actively participates in the early and effective clearance of intracellular bacteria. Notably, IL-23 promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, alongside other IL-17-producing cells. The heterodimeric association of IL-23 with IL12B, known as interleukin IL-23, is disulfide-linked. Furthermore, IL-23 interacts with IL23R, facilitating the recruitment of IL12RB1.

Biological Activity

Measured by its ability to induce IL-17 secretion by CTLL-2 cells. The ED50 for this effect is 2.703 ng/mL, corresponding to a specific activity is 3.7×10^5 U/mg.

  • Measured by its ability to induce IL-17 secretion by CTLL-2 cells.The ED50 for this effect is 2.703 ng/mL, corresponding to a specific activity is 3.7×105 U/mg.
Species

Mouse; Human

Source

HEK293

Tag

C-His;C-6*His

Accession

Q9NPF7 (R20-P189)&P43432 (M23-S335)

Gene ID
Synonyms
IL-23 p19/IL-12 p40; IL23; IL-23A; Interleukin 23; SGRF
AA Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Weight

Approximately 23.18 & 40-50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His)
Cat. No.:
HY-P74874
Quantity:
MCE Japan Authorized Agent: