1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interferon & Receptors Cytokine Receptors
  4. IFN-gamma Receptor
  5. IFN-gamma R1
  6. IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc)

IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P73133
Handling Instructions Technical Support

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc) is a recombinant mouse IFN-gamma R1 (A26-D253) with C-terminal hFc tag, which is produced in HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)[2]. IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc) is a recombinant mouse IFN-gamma R1 (A26-D253) with C-terminal hFc tag, which is produced in HEK293 cells.

Background

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1 deficiencies are associated with immune responses mediated by IFN-γ, and increased susceptibility to infections. IFN-gamma R1 signaling pathway is important in activating cancer cell death and inhibiting cancer progression[3]
Mouse IFN-gamma R1 consists of extracellular domain (A26-S254), helical domain (I255-Y275), and cytoplasmic domain (W276-S477). The sequence of amino acids in IFNAR1 differs in different species. Mouse IFN-gamma R1 shares 50% aa sequence identity with human. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses[2].

In Vitro

IFN-gamma R1 (murine, -2 μg/mL, 4 h) suppresses AP(+)-exosome-mediated NO synthesis in RAW264.7 cells[4].

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P15261 (A26-D253)

Gene ID
Molecular Construction
N-term
IFNGR1 (A26-D253)
Accession # P15261
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Interferon gamma receptor 1; IFN-gamma-R1; CD119; Ifngr1; Ifngr
AA Sequence

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKD

Predicted Molecular Mass
53 kDa
분자량

Approximately 70-75 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IFN-gamma R1/CD119 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73133
수량:
MCE Japan Authorized Agent: