1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 1/IL-29
  6. IFN-lambda 1/IL-29 Protein, Human (HEK293)

IFN-lambda 1/IL-29 Protein, Human (HEK293)

Cat. No.: HY-P73202
COA Handling Instructions

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2. IFN-lambda 1 modulates immunity in infections and autoimmune diseases. IFN-lambda 1/IL-29 Protein, Human (HEK293) is a recombinant human IFN-lambda 1 (M1-T200) without any tag, which is produced in HEK293 cell.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $160 In-stock
50 μg $350 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2[1]. IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2]. IFN-lambda 1/IL-29 Protein, Human (HEK293) is a recombinant human IFN-lambda 1 (M1-T200) without any tag, which is produced in HEK293 cell.

Background

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 is produced mainly by maturing dendritic cells and macrophages. Maturing dendritic cells, macrophages, mast cells, and alveolar cells express high levels of IFN-lambda 1[3].
IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2[1]. Activated STAT1 and STAT2 recruits IRF-9 to form a trimeric transcription factor complex (ISGF3), which mediates the antiviral state[4].
IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2].

In Vitro

IFN-lambda 1 (human, 1-1 ng/mL, 48 h) increases the expression of proinflammatory cytokine in osteoarthritis (OA) synovial fibroblasts (FLS)[5].
IFN-lambda 1 (human, -2 ng/mL, 24h) increases expression of the proinflammatory factor IL-8 in human blood monocyte-derived DCs[6].

Biological Activity

Measured in antiviral assays using HepG2 cells infected with vesicular stomatitis virus and the ED50 is typically 3-39 ng/mL.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q8IU54 (M1-T200)

Gene ID
Synonyms
IFN-λ1/IL-29; IL-29; IFN-lambda-1; Cytokine Zcyto21; Interleukin-29
AA Sequence

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Molecular Weight

Approximately 20.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-lambda 1/IL-29 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-lambda 1/IL-29 Protein, Human (HEK293)
Cat. No.:
HY-P73202
Quantity:
MCE Japan Authorized Agent: