1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 1/IL-29
  6. IFN-lambda 1/IL-29 Protein, Human (HEK293)

IFN-lambda 1/IL-29 Protein, Human (HEK293)

Cat. No.: HY-P73202
SDS COA Handling Instructions

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2. IFN-lambda 1 modulates immunity in infections and autoimmune diseases. IFN-lambda 1/IL-29 Protein, Human (HEK293) is a recombinant human IFN-lambda 1 (G20-T200) without any tag, which is produced in HEK293 cell.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $160 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2[1]. IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2]. IFN-lambda 1/IL-29 Protein, Human (HEK293) is a recombinant human IFN-lambda 1 (G20-T200) without any tag, which is produced in HEK293 cell.

Background

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 is produced mainly by maturing dendritic cells and macrophages. Maturing dendritic cells, macrophages, mast cells, and alveolar cells express high levels of IFN-lambda 1[3].
IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2[1]. Activated STAT1 and STAT2 recruits IRF-9 to form a trimeric transcription factor complex (ISGF3), which mediates the antiviral state[4].
IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2].

In Vitro

IFN-lambda 1 (human, 1-1 ng/mL, 48 h) increases the expression of proinflammatory cytokine in osteoarthritis (OA) synovial fibroblasts (FLS)[5].
IFN-lambda 1 (human, -2 ng/mL, 24h) increases expression of the proinflammatory factor IL-8 in human blood monocyte-derived DCs[6].

Biological Activity

Measured in antiviral assays using HepG2 cells infected with vesicular stomatitis virus and the ED50 is typically 3-39 ng/mL.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q8IU54 (G20-T200)

Gene ID
Molecular Construction
N-term
IFN-λ1 (G20-T200)
Accession # Q8IU54
C-term
Synonyms
IFN-λ1/IL-29; IL-29; IFN-lambda-1; Cytokine Zcyto21; Interleukin-29
AA Sequence

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Molecular Weight

Approximately 20.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-lambda 1/IL-29 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-lambda 1/IL-29 Protein, Human (HEK293)
Cat. No.:
HY-P73202
Quantity:
MCE Japan Authorized Agent: