IFN-lambda 1/IL-29 Protein, Human (HEK293, His)
Based on 1 Customer Validation
IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2. IFN-lambda 1 modulates immunity in infections and autoimmune diseases. IFN-lambda 1/IL-29 Protein, Human (HEK293, His) is a recombinant human IFN-lambda 1 (G20-T200) with C-terminal 10*His tag, which is produced in HEK293.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2[1]. IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2]. IFN-lambda 1/IL-29 Protein, Human (HEK293, His) is a recombinant human IFN-lambda 1 (G20-T200) with C-terminal 10*His tag, which is produced in HEK293.
Background
IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 is produced mainly by maturing dendritic cells and macrophages. Maturing dendritic cells, macrophages, mast cells, and alveolar cells express high levels of IFN-lambda 1[3].
IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2[1]. Activated STAT1 and STAT2 recruits IRF-9 to form a trimeric transcription factor complex (ISGF3), which mediates the antiviral state[4].
IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2].
In Vitro
IFN-lambda 1 (human, 1-100 ng/mL, 48 h) increases the expression of proinflammatory cytokine in osteoarthritis (OA) synovial fibroblasts (FLS)[5].
IFN-lambda 1 (human, 0-200 ng/mL, 24h) increases expression of the proinflammatory factor IL-8 in human blood monocyte-derived DCs[6].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
Q8IU54 (G20-T200)
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNL1; Cytokine Zcyto21; Prev. IL29; IFN-Lambda-1; IL-29; Interferon 1IB1; Interleukin 29 (Interferon, Lambda 1); Interleukin 29; Interferon Lambda-1; ZCYTO21; Interferon Lambda 1; Interleukin-29
-
AA Sequence
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
-
Predicted Molecular Mass
21.4 kDa
-
Molecular Weight
Approximately 25-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30(8):555-64. [Content Brief]
[2]. Wu Q, et al. Serum IFN-λ1 is abnormally elevated in rheumatoid arthritis patients. Autoimmunity. 2013 Feb;46(1):40-3. [Content Brief]
[3]. Kelm NE, et al. The role of IL-29 in immunity and cancer. Crit Rev Oncol Hematol. 2016 Oct;106:91-8. [Content Brief]
[4]. Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57(2):171-9. [Content Brief]
[5]. Xu L, et al. Interleukin-29 Enhances Synovial Inflammation and Cartilage Degradation in Osteoarthritis. Mediators Inflamm. 2016;2016:9631510. [Content Brief]
[6]. Yu Y, et al. Hepatitis B virus induces a novel inflammation network involving three inflammatory factors, IL-29, IL-8, and cyclooxygenase-2. J Immunol. 2011 Nov 1;187(9):4844-60. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)