IL-10R beta Protein, Rat (HEK293, Fc)

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses.IL-10R beta Protein, Rat (HEK293, Fc) is expressed by HEK 293 cells and consists of 351 amino acids (M1-V351) with a Fc tag at the C-terminus^[3].

IL-10 receptor complex consists of a heterodimer of four transmembrane chains, two of which form IL-10R alpha and two of which form IL-10R beta. IL-10R beta, originally known as the orphan receptor CRF2-4, is an essential accessory subunit for the active interleukin 10 receptor complex^[1].
IL-10R beta can bind to IL-10 via the JAK-STAT pathway, and activation of the IL-10 receptor complex leads to phosphorylation of the receptor-associated proteins TYK and JAK-1, and ultimately to activation of the transcription factors STAT3, STAT1, and STAT5, which regulate the expression of IL-10-responsive genes, including c-myc, bcl-2, and bcl-xL, initiating signal transduction^[2].
IL-10R beta is expressed on most cell types and is also a shared cell surface receptor required for the activation of five class II cytokines (IL-10, IL-22, IL-26, IL-28 and IFNL1), which play a key role in host defense, immune regulation. Among them, the IFNLR1/IL10R beta dimer is the receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity^[3].

IL-1R beta and IL-22R1 mRNA expression is significantly higher than that of healthy controls, but the peak expression of IL-22R1 in the male Sprague-Dawley rat pneumonia model is earlier than that of IL-1R beta. Since the IL-22 receptor consists of two chains, IL-22R1 and IL-1R beta, IL-22 may serve as a potential biomarker for early diagnosis of Klebsiella pneumoniae^[4].

Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Rat IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED₅₀ for this effect is 1.112 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Rat IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED₅₀ for this effect is 1.112 μg/mL.

Rat

HEK293

C-hFc

NP_001100581.1 (M22-P222)

304091  [NCBI]

Partial

MIPPPENVRMNSVNFKNILQWEVPAFPKENLTFTAQYESYWYFQDRCKNTASTHCDFSVLSKYGDHTVRVRTELADEHSEWVNVTFCPVEDTIIGPPEMQTESLADSIHMRFSAPQIENEPETWTMKNIYNSWAYRVQYWKNGTKEKFQVTSQYDSEVLRDLEPWTTYCIQVQGFLLDQNRTGEWSKPVCERTTSDETTPP

Approximately 68 kDa.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Sung-Il Yoon, et al. Structure and mechanism of receptor sharing by the IL-10R2 common chain. Structure. 2010 May 12;18(5):638-48.  [Content Brief]

  [2]. J Shi, et al. IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways. Cell Death Dis. 2016 Mar 10;7(3):e2133.  [Content Brief]

  [3]. Paul Sheppard, et al. IL-28, IL-29 and their class II cytokine receptor IL-28R. Nat Immunol. 2003 Jan;4(1):63-8.  [Content Brief]

  [4]. Jianyong Fan, et al. The expression of β-Defensin-2, IL-22, IL-22R1 and IL-10R2 in rat model of Klebsiella pneumonia and their correlation with histological grades. Exp Lung Res. 2020 May-Jun;46(5):109-116.  [Content Brief]