IL-9 Protein, Human (HEK293, His)

IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. IL-9 Protein, Human (HEK293, His) is the recombinant human-derived IL-9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-9 Protein, Human (HEK293, His) is 126 a.a., with molecular weight of 25-40 kDa.

IL-9 protein, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, plays crucial roles in the immune response against parasites. Its impact extends to intestinal epithelial permeability and adaptive immunity. IL-9 further contributes to the differentiation of specific T-cell subsets, including IL-17 producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Functionally, IL-9 exerts its biological effects through a receptor composed of the IL9R subunit and the signal transducing subunit IL2RG. Receptor stimulation rapidly activates JAK1 and JAK3 kinase activities, leading to STAT1, STAT3, and STAT5-mediated transcriptional programs. While the induction of differentiation genes appears to be mediated by STAT1 alone, the protection of cells from apoptosis depends on STAT3 and STAT5. IL-9 interacts with the IL9R subunit and IL2RG, forming a molecular basis for its diverse cellular effects.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.05889 ng/mL, corresponding to a specific activity is 1.7×10⁷ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.05889 ng/mL, corresponding to a specific activity is 1.7×10⁷ units/mg.

Human

HEK293

C-6*His

P15248 (Q19-I144)

3578  [NCBI]

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

25-40 kD

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.