Copy Link Print Information

IL-9 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. IL-9 Protein, Human (HEK293, His) is the recombinant human-derived IL-9 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-9 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-9 Protein, Human (HEK293, His)
  • IL-9 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. IL-9 Protein, Human (HEK293, His) is the recombinant human-derived IL-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL-9 protein, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, plays crucial roles in the immune response against parasites. Its impact extends to intestinal epithelial permeability and adaptive immunity. IL-9 further contributes to the differentiation of specific T-cell subsets, including IL-17 producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Functionally, IL-9 exerts its biological effects through a receptor composed of the IL9R subunit and the signal transducing subunit IL2RG. Receptor stimulation rapidly activates JAK1 and JAK3 kinase activities, leading to STAT1, STAT3, and STAT5-mediated transcriptional programs. While the induction of differentiation genes appears to be mediated by STAT1 alone, the protection of cells from apoptosis depends on STAT3 and STAT5. IL-9 interacts with the IL9R subunit and IL2RG, forming a molecular basis for its diverse cellular effects.

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.05889 ng/mL, corresponding to a specific activity is 1.7×107 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.05889 ng/mL, corresponding to a specific activity is 1.7×107 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P15248 (Q19-I144)

  • Gene ID
    3578  [NCBI]
  • Molecular Construction
    • N-term
    • IL-9 (Q19-I144)
      Accession # P15248
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL9; Homolog Of Mouse T Cell And Mast Cell Growth Factor 40; Interleukin 9; P40 T-Cell And Mast Cell Growth Factor; IL-9; Interleukin-9; T-Cell Growth Factor P40; P40 Cytokine; HP40; Cytokine P40; P40

  • AA Sequence

    QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

  • Predicted Molecular Mass

    15.2 kDa

  • Molecular Weight

    Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.05889 ng/mL, corresponding to a specific activity is 1.7×107 units/mg.

  • IL-9 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-9 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-9 Protein, Human (HEK293, His)
  • IL-9 Protein, Human (HEK293, His) Product Image