1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 beta/CCL19
  6. MIP-3 beta/CCL19 Protein, Mouse

MIP-3 beta/CCL19 Protein, Mouse is a CC chemokine that is strongly chemotactic for CD4 T cells and CD8 T cells and acts as a ligand that binds specifically to the chemokine receptor CCR7 to mediate tissue immunity, inflammatory responses, and antiviral infections. MIP-3 beta/CCL19 Protein, Mouse is a recombinant mouse MIP-3 beta/CCL19 (G26-S108) protein expressed by E. coli.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

MIP-3 beta/CCL19 Protein, Mouse Recomendaciones destacadas:

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

MIP-3 beta/CCL19 Protein, Mouse is a CC chemokine that is strongly chemotactic for CD4 T cells and CD8 T cells and acts as a ligand that binds specifically to the chemokine receptor CCR7 to mediate tissue immunity, inflammatory responses, and antiviral infections. MIP-3 beta/CCL19 Protein, Mouse is a recombinant mouse MIP-3 beta/CCL19 (G26-S108) protein expressed by E. coli[1][2].

Background

CCL19, also known as MIP-3 beta, is an immunostable chemokine that is located on chromosome 9 in the human genome. CCL19 is abundantly expressed in the thymus and lymph nodes, moderately expressed in the trachea and colon, and less expressed in the stomach, small intestine, lung, kidney, and spleen. CCL19 binds to and functions as a chemokine receptor, CCR7. CCR7 is the first CCR7 is the first lymphocyte-specific G protein-coupled receptor (GPCR) identified with seven transmembrane alpha helices. CCR7 is expressed on both double-negative and single-positive thymocytes, including naive T cells, central memory T cells, regulatory T cells, naive B cells, semimature/mature DCs and NK cells, as well as a few tumor cells, where it serves as a key regulator for directing steady-state lymphocytes to secondary lymphoid organs. In contrast, CCL19 is the only chemokine known to effectively stimulate β-arrestin-mediated phosphorylation and internalization of CCR7, leading to receptor desensitization and migration of antigen (Ag)-presenting DCs, thereby affecting T cell responses. The CCL19-CCR7-based signaling pathway plays an important role in tissue immunity and inflammatory response memory. In addition, it also plays a role in vaccine-based protection against a variety of viruses, such as HIV-1 infection, hepatitis C virus (HCV), and herpes simplex virus 1 (HSV-1), etc. The interaction of CCL19 and CCR7 also contributes to the release of antiviral-associated cytokines (e.g., IFN-γ and IL-4) by immune cells, thereby promoting T cell proliferation and DC uptake of antigens[1][2].

In Vitro

CCL19 (1 μg/mL, 6 h) induces T cell proliferation in immature mouse dendritic cells (DC)-T cell co-culture systems, induces upregulation of costimulatory molecules and cytokine production in DCs, and maturation of DC to induce the Th1 response in DC isolated from spleens and mesenteric lymph nodes of naïve BALB/c mice[3].

In Vivo

CCL19 (5 mg/mouse by osmotic pump) significantly increases IL-10 production in plt (plt) mice,and after treatment with 100 mg acetylcholine, the number of lymphocytes at bronchoalveolar lavage fluid (BALF) and enhanced pause (Penh) levels is significantly lower in CCL19-treated mice than in untreated mice[2].
CCL19 can lead to rapid clearance of intrahepatic HBV likely through increased intrahepatic CD8+ T-cell proportion, decreased frequency of PD-1+ CD8+ T cells in blood and compromised suppression of hepatic APCs, with lymphocytes producing a significantly high level of Ag-responsive TNF-α and IFN-γ from CD8+ T cells in C57BL/6 mice transfected with the mouse CCL19-encoding plasmid[4].

Actividad biológica

1.Full biological activity determined by a chemotaxis bioassay using human mature dendritic cells is in a concentration range of 10-100 ng/ml.
2.Biological activity was determined by its ability to chemoattract Jurkat human T cells using a concentration of 28.96-38.19 ng/mL.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7. The ED50 for this effect is 10.0-20.0 ng/mL, corresponding to a specific activity is ≤8.019×104 U/mg.

  • Biological activity was determined by its ability to chemoattract Jurkat cells using a concentration of 28.96 ng/mL, corresponding to a specific activity is 3.453×104 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O70460 (G26-S108)

Gene ID
Molecular Construction
N-term
CCL19 (G26-S108)
Accession # O70460
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuMIP-3β/CCL19; C-C motif chemokine 19; SCYA19
AA Sequence

GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Predicted Molecular Mass
9.2 kDa
Peso molecular

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, pH 2.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

MIP-3 beta/CCL19 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

MIP-3 beta/CCL19 Protein, Mouse

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
MIP-3 beta/CCL19 Protein, Mouse
Cat. No.:
HY-P7264
Cantidad:
MCE Japan Authorized Agent: