NLK/Nemo Like Kinase Protein, Human (Active, sf9, His-GST)

NLK/Nemo-like kinase protein is a key serine/threonine protein kinase that directs cell fate through multiple regulatory effects. As a non-canonical Wnt pathway effector, NLK affects transcription factors downstream of WNT5A, MAP3K7/TAK1, and HIPK2. NLK/Nemo Like Kinase Protein, Human (sf9, His-GST) is the recombinant human-derived NLK/Nemo Like Kinase protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.

NLK/Nemo Like Kinase Protein, a serine/threonine-protein kinase, plays a crucial role in cell fate determination by regulating various transcription factors. As a positive effector of the non-canonical Wnt signaling pathway, NLK acts downstream of WNT5A, MAP3K7/TAK1, and HIPK2. Simultaneously, it serves as a negative regulator of the canonical Wnt/beta-catenin signaling pathway by binding to and phosphorylating TCF7L2/TCF4 and LEF1, leading to the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA and the subsequent ubiquitination and proteolysis of LEF1. NLK also negatively modulates the Notch signaling pathway by phosphorylating NOTCH1, preventing the formation of a transcriptionally active ternary complex. Moreover, NLK inhibits the MYB family of transcription factors through phosphorylation, which leads to their proteolysis or interaction inhibition with the coactivator CREBBP. Additionally, NLK phosphorylates STAT3 downstream of IL6 and MAP3K7/TAK1, cooperates with ATF5 to activate C/EBP subfamily members upon IL1B stimulus, and acts as an inhibitor of the mTORC1 complex in response to osmotic stress by phosphorylating RPTOR.

Human

Sf9 insect cells

N-GST;N-His

Q9UBE8 (V121-E527)

51701  [NCBI]

Partial

VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE

Approximately 73 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.