1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. MAPK
  5. NLK/Nemo Like Kinase
  6. NLK/Nemo Like Kinase Protein, Human (Active, sf9, His-GST)

NLK/Nemo Like Kinase Protein, Human (Active, sf9, His-GST)

Cat. No.: HY-P76517
Handling Instructions Technical Support

NLK/Nemo-like kinase protein is a key serine/threonine protein kinase that directs cell fate through multiple regulatory effects. As a non-canonical Wnt pathway effector, NLK affects transcription factors downstream of WNT5A, MAP3K7/TAK1, and HIPK2. NLK/Nemo Like Kinase Protein, Human (sf9, His-GST) is the recombinant human-derived NLK/Nemo Like Kinase protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NLK/Nemo-like kinase protein is a key serine/threonine protein kinase that directs cell fate through multiple regulatory effects. As a non-canonical Wnt pathway effector, NLK affects transcription factors downstream of WNT5A, MAP3K7/TAK1, and HIPK2. NLK/Nemo Like Kinase Protein, Human (sf9, His-GST) is the recombinant human-derived NLK/Nemo Like Kinase protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.

Background

NLK/Nemo Like Kinase Protein, a serine/threonine-protein kinase, plays a crucial role in cell fate determination by regulating various transcription factors. As a positive effector of the non-canonical Wnt signaling pathway, NLK acts downstream of WNT5A, MAP3K7/TAK1, and HIPK2. Simultaneously, it serves as a negative regulator of the canonical Wnt/beta-catenin signaling pathway by binding to and phosphorylating TCF7L2/TCF4 and LEF1, leading to the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA and the subsequent ubiquitination and proteolysis of LEF1. NLK also negatively modulates the Notch signaling pathway by phosphorylating NOTCH1, preventing the formation of a transcriptionally active ternary complex. Moreover, NLK inhibits the MYB family of transcription factors through phosphorylation, which leads to their proteolysis or interaction inhibition with the coactivator CREBBP. Additionally, NLK phosphorylates STAT3 downstream of IL6 and MAP3K7/TAK1, cooperates with ATF5 to activate C/EBP subfamily members upon IL1B stimulus, and acts as an inhibitor of the mTORC1 complex in response to osmotic stress by phosphorylating RPTOR.

Species

Human

Source

Sf9 insect cells

Tag

N-GST;N-His

Accession

Q9UBE8 (V121-E527)

Gene ID
Molecular Construction
N-term
His-GST
NLK (V121-E527)
Accession # Q9UBE8
C-term
Protein Length

Partial

Synonyms
Serine/threonine-protein kinase NLK; Nemo-like kinase; NLK
AA Sequence

VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE

Predicted Molecular Mass
74.1 kDa
Molecular Weight

Approximately 73 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NLK/Nemo Like Kinase Protein, Human (Active, sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NLK/Nemo Like Kinase Protein, Human (Active, sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NLK/Nemo Like Kinase Protein, Human (Active, sf9, His-GST)
Cat. No.:
HY-P76517
Quantity:
MCE Japan Authorized Agent: