PCSK9 Protein, Macaca nemestrina (HEK293, His)

Customer Review

Based on 1 Customer Validation

The PCSK9 protein controls plasma cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2 to promote their degradation. It prevents LDLR recycling and directs it to lysosomes for degradation. PCSK9 induces LDLR ubiquitination, inhibits APOB degradation, disposes of BACE1 intermediates, reduces ENaC surface expression, and regulates neuronal apoptosis through LRP8/APOER2. PCSK9 Protein, Macaca nemestrina (HEK293, His) is the recombinant cynomolgus-derived PCSK9 protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PCSK9 protein controls plasma cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2 to promote their degradation. It prevents LDLR recycling and directs it to lysosomes for degradation. PCSK9 induces LDLR ubiquitination, inhibits APOB degradation, disposes of BACE1 intermediates, reduces ENaC surface expression, and regulates neuronal apoptosis through LRP8/APOER2. PCSK9 Protein, Macaca nemestrina (HEK293, His) is the recombinant cynomolgus-derived PCSK9 protein, expressed by HEK293, with C-6*His labeled tag.

Background

PCSK9 protein plays a crucial role in maintaining the balance of plasma cholesterol levels. It interacts with low-density lipoprotein receptor family members such as LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2, promoting their degradation within acidic compartments of the cell. Through a non-proteolytic mechanism, it enhances the degradation of hepatic LDLR via a clathrin LDLRAP1/ARH-mediated pathway, preventing its recycling from endosomes to the cell surface and directing it to lysosomes for degradation. Additionally, PCSK9 can induce ubiquitination of LDLR, leading to its subsequent degradation. It also inhibits the intracellular degradation of APOB, independent of LDLR, by affecting the autophagosome/lysosome pathway. Moreover, PCSK9 is involved in the early secretory pathway by disposing of non-acetylated intermediates of BACE1. It further regulates epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by reducing ENaC surface expression, primarily through increased proteasomal degradation. Finally, PCSK9 modulates neuronal apoptosis by regulating the levels of LRP8/APOER2 and related anti-apoptotic signaling pathways.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Others
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PCSK9 (Q31-Q152&S153-Q692)
      Accession # A8T662
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PCSK9; PC9; Prev. HCHOLA3; Hypercholesterolemia, Autosomal Dominant 3; NARC-1; Neural Apoptosis Regulated Convertase 1; Subtilisin/Kexin-Like Protease PC9; Neural Apoptosis-Regulated Convertase 1; FH3; LDLCQ1; Proprotein Convertase 9; FHCL3; NARC1; Propro

  • AA Sequence

    QEDEDGDYEELVLALRSEEDGLADAPEHGATATFHRCAKDPWRLPGTYVVVLKEETHRSQSERTARRLQAQAARRGYLTKILHVFHHLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ&SIPWNLERITPARYRADEYQPPKGGSLVEVYLLDTSIQSDHREIEGRVMVTDFESVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGAGLRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVFNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSRSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHRAGWQLFCRTVWSAHSGPTRMATAVARCAQDEELLSCSSFSRSGKRRGERIEAQGGKRVCRAHNAFGGEGVYAIARCCLLPQVNCSVHTAPPAGASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVIVACEDGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVAAVAICCRSRHLVQASQELQ

  • Predicted Molecular Mass

    14 kDa & 59 kDa

  • Molecular Weight

    Approximately 16-21 kDa & 55-77 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.1 M Arg, 0.1 M Glu, 20% glycerol, 0.01% Tween 20, 5% trehalose, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00