TECK/CCL25 Protein, Human

고객리뷰

Based on 1 Customer Validation

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25(Q24-L150) protein expressed byE. coli.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Human
  • Source: E. coli
  • 보관:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • References
  • Help & FAQs

Biological Activity

제품 설명

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25(Q24-L150) protein expressed byE. coli[1][2].

Background

CCL25, also known as thymus-expressing chemokine TECK, a small cell factor of the CC chemokine family, is located on chromosome 19 in the human genome. CCL25 is mainly expressed in the thymus and intestinal epithelium, but can also be produced by parenchymal cells such as vascular endothelial cells, which can migrate immature T cells to the thymus for mature release. It is chemotactic for thymocytes, macrophages and dendritic cells and can act in combination with the chemokine receptor CCR9. Among others, CCR9 is found as a G protein-coupled receptor expressed on the cell membranes of dendritic cells, neutrophils, lymphocytes, monocyte macrophages and vascular endothelial cells. CCR9 belongs to the β-chemokine receptor family and the gene is located on chromosome 3 at p21.31. CCL25-CCR9 is involved in the development of T cells and cell migration to the small intestine, as well as in a variety of inflammatory diseases and promotes inflammatory responses, including cardiovascular disease (CVD), hepatitis, and arthritis. The interaction of CCL25 with CCR9 also supports T cell survival during thymic maturation by inhibiting apoptosis through Akt/protein kinase B activation[1][2].

In Vitro

CCL25 (100 ng/mL) can induce migration and invasion in human OvCa cell lines that are CCR9-dependent. It causes OVCAR-3 cells to significantly express MMP-8 and MMP-13 mRNA and MMP-1 and -8 active proteins, resulting in a selective but significant increase in active MMP-3 and -10 secretion by CAOV-3 cells[3].
CCL25 (100 ng/mL) significantly enhances the growth of human BrCa cell lines MDA-MB-231 cells and protects against cisplatin (<5 μg/mL)-mediated growth inhibition. CCL25-mediated protection against cisplatin-induced growth inhibition of BrCa cells disappears as cisplatin concentrations reached ≥10 μg/mL. It also significantly reduces the percentage of apoptotic cells treated with cisplatin[4].

Verified Bioactivity

Fully biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL25 (Q24-L150)
      Accession # O15444-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CCL25; Ckb15; Prev. SCYA25; Chemokine (C-C Motif) Ligand 25; TECK; Thymus Expressed Chemokine; Small-Inducible Cytokine A25; Thymus-Expressed Chemokine; C-C Motif Chemokine 25; Ck Beta-15; Chemokine TECK; TECKvar; C-C Motif Chemokine Ligand 25; Small Indu

  • AA Sequence

    QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

  • Predicted Molecular Mass

    14.3 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

견적 받기 해외재고보유

Other size
견적 받기
Please select quantity
Amount: USD 0.00