1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL25
  6. TECK/CCL25 Protein, Human

TECK/CCL25 Protein, Human

Cat. No.: HY-P7294
SDS COA Handling Instructions

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25(Q24-L150) protein expressed byE. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25(Q24-L150) protein expressed byE. coli[1][2].

Background

CCL25, also known as thymus-expressing chemokine TECK, a small cell factor of the CC chemokine family, is located on chromosome 19 in the human genome. CCL25 is mainly expressed in the thymus and intestinal epithelium, but can also be produced by parenchymal cells such as vascular endothelial cells, which can migrate immature T cells to the thymus for mature release. It is chemotactic for thymocytes, macrophages and dendritic cells and can act in combination with the chemokine receptor CCR9. Among others, CCR9 is found as a G protein-coupled receptor expressed on the cell membranes of dendritic cells, neutrophils, lymphocytes, monocyte macrophages and vascular endothelial cells. CCR9 belongs to the β-chemokine receptor family and the gene is located on chromosome 3 at p21.31. CCL25-CCR9 is involved in the development of T cells and cell migration to the small intestine, as well as in a variety of inflammatory diseases and promotes inflammatory responses, including cardiovascular disease (CVD), hepatitis, and arthritis. The interaction of CCL25 with CCR9 also supports T cell survival during thymic maturation by inhibiting apoptosis through Akt/protein kinase B activation[1][2].

In Vitro

CCL25 (100 ng/mL) can induce migration and invasion in human OvCa cell lines that are CCR9-dependent. It causes OVCAR-3 cells to significantly express MMP-8 and MMP-13 mRNA and MMP-1 and -8 active proteins, resulting in a selective but significant increase in active MMP-3 and -10 secretion by CAOV-3 cells[3].
CCL25 (100 ng/mL) significantly enhances the growth of human BrCa cell lines MDA-MB-231 cells and protects against cisplatin (<5 μg/mL)-mediated growth inhibition. CCL25-mediated protection against cisplatin-induced growth inhibition of BrCa cells disappears as cisplatin concentrations reached ≥10 μg/mL. It also significantly reduces the percentage of apoptotic cells treated with cisplatin[4].

Biological Activity

Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O15444-1 (Q24-L150)

Gene ID
Molecular Construction
N-term
CCL25 (Q24-L150)
Accession # O15444-1
C-term
Synonyms
rHuTECK/CCL25; C-C motif chemokine 25; SCYA25
AA Sequence

MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Molecular Weight

Approximately 14.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TECK/CCL25 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TECK/CCL25 Protein, Human
Cat. No.:
HY-P7294
Quantity:
MCE Japan Authorized Agent: