TECK/CCL25 Protein, Human

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25(Q24-L150) protein expressed byE. coli^[1][2].

CCL25, also known as thymus-expressing chemokine TECK, a small cell factor of the CC chemokine family, is located on chromosome 19 in the human genome. CCL25 is mainly expressed in the thymus and intestinal epithelium, but can also be produced by parenchymal cells such as vascular endothelial cells, which can migrate immature T cells to the thymus for mature release. It is chemotactic for thymocytes, macrophages and dendritic cells and can act in combination with the chemokine receptor CCR9. Among others, CCR9 is found as a G protein-coupled receptor expressed on the cell membranes of dendritic cells, neutrophils, lymphocytes, monocyte macrophages and vascular endothelial cells. CCR9 belongs to the β-chemokine receptor family and the gene is located on chromosome 3 at p21.31. CCL25-CCR9 is involved in the development of T cells and cell migration to the small intestine, as well as in a variety of inflammatory diseases and promotes inflammatory responses, including cardiovascular disease (CVD), hepatitis, and arthritis. The interaction of CCL25 with CCR9 also supports T cell survival during thymic maturation by inhibiting apoptosis through Akt/protein kinase B activation^[1][2].

CCL25 (100 ng/mL) can induce migration and invasion in human OvCa cell lines that are CCR9-dependent. It causes OVCAR-3 cells to significantly express MMP-8 and MMP-13 mRNA and MMP-1 and -8 active proteins, resulting in a selective but significant increase in active MMP-3 and -10 secretion by CAOV-3 cells^[3].
CCL25 (100 ng/mL) significantly enhances the growth of human BrCa cell lines MDA-MB-231 cells and protects against cisplatin (<5 μg/mL)-mediated growth inhibition. CCL25-mediated protection against cisplatin-induced growth inhibition of BrCa cells disappears as cisplatin concentrations reached ≥10 μg/mL. It also significantly reduces the percentage of apoptotic cells treated with cisplatin^[4].

Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

Human

E. coli

Tag Free

O15444 (Q24-L150)

6370  [NCBI]

MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Approximately 14.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Marcus Svensson, et al. CCL25 mediates the localization of recently activated CD8alphabeta(+) lymphocytes to the small-intestinal mucosa. J Clin Invest. 2002 Oct;110(8):1113-21.  [Content Brief]

  [2]. Xue Wu, et al. The Roles of CCR9/CCL25 in Inflammation and Inflammation-Associated Diseases. Front Cell Dev Biol. 2021 Aug 19;9:686548.  [Content Brief]

  [3]. Erica L Johnson, et al. CCL25-CCR9 interaction modulates ovarian cancer cell migration, metalloproteinase expression, and invasion. World J Surg Oncol. 2010 Jul 22;8:62.  [Content Brief]

  [4]. Crystal Johnson-Holiday, et al. CCR9-CCL25 interactions promote cisplatin resistance in breast cancer cell through Akt activation in a PI3K-dependent and FAK-independent fashion. World J Surg Oncol. 2011 May 3;9:46.  [Content Brief]