TIMP-4 Protein, Human (HEK293, His)

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIMP-4 Protein, Human (HEK293, His) is 195 a.a., with molecular weight of ~24.0 kDa.

Tissue inhibitor of metalloproteinases-4 (TIMP-4) is a protein that forms complexes with metalloproteinases, including collagenases, leading to their irreversible inactivation through binding to their catalytic zinc cofactor. TIMP-4 exhibits broad-spectrum inhibitory activity, known to act on various matrix metalloproteinases (MMPs) such as MMP-1, MMP-2, MMP-3, MMP-7, and MMP-9. By regulating the activity of these MMPs, TIMP-4 plays a crucial role in modulating extracellular matrix remodeling, thereby influencing processes like tissue development, maintenance, and repair. The ability of TIMP-4 to interact with and inhibit multiple MMPs highlights its importance in maintaining the balance of proteolytic activities and underscores its potential significance in various physiological and pathological contexts. (

Human

HEK293

C-6*His

Q99727 (C30-P224)

7079  [NCBI]

CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Approximately 24.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.