TIMP-4 Protein, Human (HEK293, His)

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Tissue inhibitor of metalloproteinases-4 (TIMP-4) is a protein that forms complexes with metalloproteinases, including collagenases, leading to their irreversible inactivation through binding to their catalytic zinc cofactor. TIMP-4 exhibits broad-spectrum inhibitory activity, known to act on various matrix metalloproteinases (MMPs) such as MMP-1, MMP-2, MMP-3, MMP-7, and MMP-9. By regulating the activity of these MMPs, TIMP-4 plays a crucial role in modulating extracellular matrix remodeling, thereby influencing processes like tissue development, maintenance, and repair. The ability of TIMP-4 to interact with and inhibit multiple MMPs highlights its importance in maintaining the balance of proteolytic activities and underscores its potential significance in various physiological and pathological contexts. (

Human

HEK293

C-6*His

Q99727 (C30-P224)

7079  [NCBI]

Full Length of Mature Protein

CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.