Copy Link Print Information

TIMP-4 Protein, Human (HEK293, His)

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TIMP-4 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Tissue inhibitor of metalloproteinases-4 (TIMP-4) is a protein that forms complexes with metalloproteinases, including collagenases, leading to their irreversible inactivation through binding to their catalytic zinc cofactor. TIMP-4 exhibits broad-spectrum inhibitory activity, known to act on various matrix metalloproteinases (MMPs) such as MMP-1, MMP-2, MMP-3, MMP-7, and MMP-9. By regulating the activity of these MMPs, TIMP-4 plays a crucial role in modulating extracellular matrix remodeling, thereby influencing processes like tissue development, maintenance, and repair. The ability of TIMP-4 to interact with and inhibit multiple MMPs highlights its importance in maintaining the balance of proteolytic activities and underscores its potential significance in various physiological and pathological contexts. (

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q99727 (C30-P224)

  • Gene ID
    7079  [NCBI]
  • Molecular Construction
    • N-term
    • TIMP-4 (C30-P224)
      Accession # Q99727
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TIMP4; Tissue Inhibitor Of Metalloproteinase 4; TIMP Metallopeptidase Inhibitor 4; Metalloproteinase Inhibitor 4; Tissue Inhibitor Of Metalloproteinases 4; TIMP-4

  • AA Sequence

    CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

  • Predicted Molecular Mass

    23.5 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TIMP-4 Protein, Human (HEK293, His) Product Image
    1/16
  • TIMP-4 Protein, Human (HEK293, His) Product Image