2. Membrane Transporter/Ion Channel Neuronal Signaling
  3. Calcium Channel
  4. ω-Agatoxin IVA TFA

ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50 values of 2 nM and 90 nM. ω-Agatoxin IVA TFA inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA inhibits Capsaicin (HY-10448)-induced CGRP release and vasodilation. ω-Agatoxin IVA TFA can be used for the research of neurological and cardiovascular disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ω-Agatoxin IVA TFA

ω-Agatoxin IVA TFA Chemical Structure

Size Price Stock Quantity
100 μg In-stock
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of ω-Agatoxin IVA TFA:

ω-Agatoxin IVA TFA Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE ω-Agatoxin IVA TFA

View All Calcium Channel Isoform Specific Products:

View All Isoforms
N-type calcium channel L-type calcium channel P/Q-type calcium channel T-type calcium channel Calcium Channel

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50 values of 2 nM and 90 nM. ω-Agatoxin IVA TFA inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA inhibits Capsaicin (HY-10448)-induced CGRP release and vasodilation. ω-Agatoxin IVA TFA can be used for the research of neurological and cardiovascular disease[1][2][3].

IC50 & Target[1]

P/Q-type calcium channel

 

In Vitro

ω-Agatoxin IVA TFA potently inhibits somatic P-type calcium channels in rat cerebellar Purkinje neurons with an IC50 of 2 nM[1].
ω-Agatoxin IVA TFA inhibits Q-type calcium channels in rat cerebellar granule neurons with an IC50 of 90 nM, which is 45-fold less potent than its activity against P-type channels[1].
ω-Agatoxin IVA TFA inhibits high potassium-induced glutamate exocytosis and calcium influx in rat cortical synaptosomes with IC50 values ranging from 30 nM to 225 nM[1].
ω-Agatoxin IVA (200 nM) TFA inhibits cloned rat brain rbA-I and rbA-II calcium channel isoforms by only 20%[1].
ω-Agatoxin IVA (100 nM) TFA does not inhibit voltage-dependent calcium currents in cultured rat sympathetic neurons[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not alter frequency-dependent neurogenic excitatory responses in isolated rabbit pulmonary artery ring preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic cholinergic excitatory responses in isolated guinea-pig myenteric plexus preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic noradrenergic excitatory responses in isolated rat vas deferens preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic excitatory responses in isolated rat bladder strip preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic noradrenergic excitatory responses in isolated rat anococcygeus muscle preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly alter neurogenic NANC inhibitory responses in isolated Atropine (HY-B1205)/Guanethidine (HY-B1251)-treated rat anococcygeus muscle and jejunum preparations preparations[2].
ω-Agatoxin IVA (0.1 μmol/L; 30 min) TFA potently inhibits Capsaicin (HY-10448)-induced CGRP release from isolated rat pial arteries[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

ω-Agatoxin IVA TFA Related Antibodies
In Vivo

ω-Agatoxin IVA (0.1 μmol/L; topical suffusion; 30 minutes before and during exposure/induction) TFA significantly inhibits Capsaicin (HY-10448)-induced vasodilation, and severely attenuates cerebral autoregulatory vasodilation and vasoconstriction responses to acute stepwise hypotension in rats[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague-Dawley with Capsaicin-induced vasodilation (male, 250 to 300 g, 12 to 14 weeks old)[3]
Dosage: 0.1 μmol/L
Administration: topical suffusion; 30 minutes before and during exposure/induction
Result: Caused a marginal 14.6% increase in baseline pial arterial diameter.
Significantly inhibited capsaicin-induced pial arterial vasodilation.
Increased the slope of the regression line for the vasodilation phase from -1.71 (vehicle) to -0.27.
Increased the slope for the vasoconstriction phase from -1.55 (vehicle) to -0.42.
Molecular Weight

5316.27

Formula

C217H360N68O60S10.C2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34)
Sequence Shortening

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (18.81 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1881 mL 0.9405 mL 1.8810 mL
5 mM 0.0376 mL 0.1881 mL 0.3762 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.52%

SDS (252 KB)

COA (243 KB) RP-HPLC (206 KB) MS (224 KB)

Handling Instructions (2659 KB)
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.1881 mL 0.9405 mL 1.8810 mL 4.7025 mL
5 mM 0.0376 mL 0.1881 mL 0.3762 mL 0.9405 mL
10 mM 0.0188 mL 0.0941 mL 0.1881 mL 0.4703 mL
15 mM 0.0125 mL 0.0627 mL 0.1254 mL 0.3135 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

ω-Agatoxin IVA TFA Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

ω-Agatoxin IVACalcium ChannelCa2+ channelsCa channelsNeuropeptidetoxinP-typeQ-typeCa2+glutamateexocytosisinfluxserotoninnorepinephrineInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ω-Agatoxin IVA TFA
Cat. No.:
HY-P1080A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.