β-Amyloid (1-42), (rat/mouse) TFA
Based on 8 publication(s) in Google Scholar
β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
For research use only. We do not sell to patients.
- Purity: 95.31%
- Formula: C199H307N53O59S.xC2HF3O2
- Molecular Weight:4418.02 (free acid)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* The compound is unstable in solutions, freshly prepared is recommended.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) β-Amyloid (1-42), (rat/mouse) TFA
More- Alzheimers Res Ther. 2025 Feb 1;17(1):35. [Abstract]
- Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
- Food Funct. 2026 Feb 17. [Abstract]
- Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]
- Bioorg Chem. 2024 Sep:150:107584. [Abstract]
- Sci Rep. 2023 Aug 21;13(1):13586. [Abstract]
- Brain Res Bull. 2026 Feb:235:111749. [Abstract]
- Patent. US20240335439A1.
Customer Validation & Images
-
Flow Cytometry
-
Cell Imaging/Staining
-
WB
-
Cell Imaging/Staining
-
IF
Biological Activity
Amyloid-β[1]
β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 °C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was aged 48h at 4-8 °C. The sample was then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.
β-Amyloid (1-42), (rat/mouse) (TFA) can induce Alzheimer's disease[4].
Administration: 1 μg/μL • Hippocampal injection • single dose
(2) β-Amyloid (1-42) TFA was injected bilaterally into the hippocampus of rat brain in a volume of 1.0 μL over a period of 0.1 μL/min using 1 μL Hamilton syringe.
Behavior: β-Amyloid (1-42) TFA aggregates increased the retention time and altered the behavioral response in rats after 15 days of injection.
β-Amyloid (1-40) TFA (HY-P0265A)
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4418.02 (free acid)
-
Formula C199H307N53O59S.xC2HF3O2
-
Color White to off-white
-
Synonyms
Amyloid β-peptide (1-42) (rat/mouse) TFA
-
Sequence
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
-
Sequence Shortening
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * The compound is unstable in solutions, freshly prepared is recommended.
Publications (8)
-
Journal Impact Factor
-
Most Recent
-
Alzheimers Res Ther
Delta-opioid receptor signaling alleviates neuropathology and cognitive impairment in the mouse model of Alzheimer's disease by regulating microglia homeostasis and inhibiting HMGB1 pathway. [Abstract]2025 Feb 1;17(1):35. PMID: 39893485 -
Aging Cell
Aβ -induced excessive mitochondrial fission drives type H blood vessels injury to aggravate bone loss in APP/PS1 mice with Alzheimer's diseases. [Abstract]2025 Feb;24(2):e14374. PMID: 39411913
β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
Low-dose (1 μM) β-Amyloid (1-42), (rat/mouse) (Aβ) (1-15 μM) had a protective effect on cell survival, whereas 5 μM, 10 μM, and 15 μM Aβ significantly increased the apoptosis of ECs.
β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) caused a higher quantity of small punctate and rounded mitochondria with aberrant morphology in ECs compared with the control group.
β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
Dynamin-related protein 1 (Drp1) expression level ascertained that β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) exerted an accelerative effect on mitochondrial fission by promoting the translocation of Drp1 from cytoplasm to mitochondria.
β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) resulted in shortened and less interconnected mitochondrial structures in ECs.
-
Food Funct
From wild plant to functional ingredient: phytochemical insights and neuroprotective activity of Melissa officinalis subsp. altissima. [Abstract]2026 Feb 17. PMID: 41700802 -
Int Immunopharmacol
Aβ impairs bone vascular homeostasis in APP/PS1 mice via disrupting the mitochondrial fission-efferocytosis axis in macrophages. [Abstract]2025 Sep 10:165:115526. PMID: 40934542
β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]
β-Amyloid (1-42), (rat/mouse) (Aβ) (10-20 μM) significantly decreased the fragments of Dil+ACs fragments phagocytized by BMDMs in a concentration-dependent manner.
-
Bioorg Chem
Discovery of cinnamamide/ester triazole hybrids as potential treatment for Alzheimer's disease. [Abstract]2024 Sep:150:107584. PMID: 38964146 -
Sci Rep
Amyloid-β slows cilia movement along the ventricle, impairs fluid flow, and exacerbates its neurotoxicity in explant culture. [Abstract]2023 Aug 21;13(1):13586. PMID: 37605005 -
Brain Res Bull
Targeting IGF2BP2 alleviates high fat diet aggravated Alzheimer's disease by inhibiting ferroptosis. [Abstract]2026 Feb:235:111749. PMID: 41587665 -
Solvent & Solubility
DMSO : 50 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (294 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5. [Content Brief]
[2]. Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34. [Content Brief]
[3]. Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94. [Content Brief]
[4]. Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42)-induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41(2):139-150. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
β-Amyloid (1-42), (rat/mouse) TFA Related Classifications
HY-P1388A Related Classifications
Powered by Bioz