1. Neuronal Signaling
  2. Amyloid-β
  3. β-Amyloid (1-42), rat TFA

β-Amyloid (1-42), rat TFA (Synonyms: Amyloid β-peptide (1-42) (rat) TFA)

Cat. No.: HY-P1388A Purity: 95.52%
Handling Instructions

β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-42), rat TFA Chemical Structure

β-Amyloid (1-42), rat TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 200 In-stock
Estimated Time of Arrival: December 31
1 mg USD 320 In-stock
Estimated Time of Arrival: December 31
5 mg USD 1200 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-42), rat TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

IC50 & Target

Amyloid-β[1]

In Vitro

β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 ℃.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was aged 48h at 4-8 ℃. The sample was then centrifuged at 14000g for 10 min at 4-8 ℃; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4532.04

Formula

C₁₉₉H₃₀₇N₅₃O₅₉S.C₂HF₃O₂

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
-20°C 1 year
In solvent -80°C 6 months
-20°C 1 month
Solvent & Solubility
In Vitro: 

DMSO : 55 mg/mL (12.14 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2207 mL 1.1033 mL 2.2065 mL
5 mM 0.0441 mL 0.2207 mL 0.4413 mL
10 mM 0.0221 mL 0.1103 mL 0.2207 mL
*Please refer to the solubility information to select the appropriate solvent.
In Vivo:
  • 1.

    Add each solvent one by one:  10% DMSO    90% corn oil

    Solubility: ≥ 2.5 mg/mL (0.55 mM); Clear solution

*All of the co-solvents are provided by MCE.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

β-Amyloid (1-42), ratAmyloid β-peptide (1-42) (rat)Amyloid-ββ-amyloid peptideAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-42), rat TFA
Cat. No.:
HY-P1388A
Quantity:
MCE Japan Authorized Agent: