β-Amyloid (1-42), (rat/mouse) TFA  (Synonyms: Amyloid β-peptide (1-42) (rat/mouse) TFA)

β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Amyloid-β^[1]

β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 °C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was aged 48h at 4-8 °C. The sample was then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

β-Amyloid (1-42), (rat/mouse) (TFA) can induce Alzheimer's disease^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4418.02 (free acid)

C₁₉₉H₃₀₇N₅₃O₅₉S.xC₂HF₃O₂

Solid

White to off-white

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*The compound is unstable in solutions, freshly prepared is recommended.

• [1]. Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5.  [Content Brief]

  [2]. Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34.  [Content Brief]

  [3]. Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94.  [Content Brief]

  [4]. Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42)-induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41(2):139-150.  [Content Brief]