1. Neuronal Signaling
  2. Amyloid-β
  3. β-Amyloid (1-42), rat TFA

β-Amyloid (1-42), rat TFA (Synonyms: Amyloid β-peptide (1-42) (rat) TFA)

Cat. No.: HY-P1388A Purity: 95.17%
Handling Instructions

β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-42), rat TFA Chemical Structure

β-Amyloid (1-42), rat TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 200 In-stock
Estimated Time of Arrival: December 31
1 mg USD 320 In-stock
Estimated Time of Arrival: December 31
5 mg USD 1200 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-42), rat TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

IC50 & Target

Amyloid-β[1]

In Vitro

β-Amyloid (1-42), rat shows cytotoxic effect on the hippocampal slices at 20 μM[1]. β-Amyloid (1-42), rat causes morphological changes in NGF-induced PC12 cells, induces formed cell processes to retract in differentiated cells and affect the expression of exons 2/3 in both undifferentiated and differentiated cells[2].

Molecular Weight

4532.04

Formula

C₁₉₉H₃₀₇N₅₃O₅₉S.C₂HF₃O₂

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (22.07 mM; Need ultrasonic)

H2O : < 0.1 mg/mL (insoluble)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2207 mL 1.1033 mL 2.2065 mL
5 mM 0.0441 mL 0.2207 mL 0.4413 mL
10 mM 0.0221 mL 0.1103 mL 0.2207 mL
*Please refer to the solubility information to select the appropriate solvent.
In Vivo:
  • 1.

    Add each solvent one by one:  10% DMSO    90% corn oil

    Solubility: ≥ 2.5 mg/mL (0.55 mM); Clear solution

*All of the co-solvents are provided by MCE.
References
Cell Assay
[1]

After treating the hippocampal slices with 20 μM β-Amyloid (1-42) for 4 h, supernatant is replaced by fresh H-ASCF/3 (0.9 mL/chamber) to which 0.1 mL MTT stock solution (5 mg/mL H-ACSF/3) is added (MTT final concentration: 0.5 mg/mL). The chamber is left to rest for 15 min without carboxygenation. To stop further reduction of MTT, the medium (H-ACSF/3) is removed. The slices are transferred into 96-well plate, then pure DMSO (100 μL/slice/well) is added for dissolving formazane from the slices. (30 min in a 96-well plate). Then 70 μL DMSO solution from each slice (well) is transferred into another 96-well plate. The optical density (OD) of the dissolved formazane is measured at 550 and 620 nm[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

β-Amyloid (1-42), ratAmyloid β-peptide (1-42) (rat)Amyloid-ββ-amyloid peptideAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-42), rat TFA
Cat. No.:
HY-P1388A
Quantity:
MCE Japan Authorized Agent: