1. Induced Disease Models Products Neuronal Signaling
  2. Nervous System Disease Models Amyloid-β
  3. β-Amyloid (1-42), (rat/mouse) TFA

β-Amyloid (1-42), (rat/mouse) TFA  (Synonyms: Amyloid β-peptide (1-42) (rat/mouse) TFA)

Cat. No.: HY-P1388A
Handling Instructions Technical Support

β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Size Price Stock
500 μg Ask For Quote & Lead Time
1 mg Ask For Quote & Lead Time
5 mg Ask For Quote & Lead Time
10 mg Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of β-Amyloid (1-42), (rat/mouse) TFA:

Other Forms of β-Amyloid (1-42), (rat/mouse) TFA:

Top Publications Citing Use of Products

    β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526.  [Abstract]

    β-Amyloid (1-42), (rat/mouse) (Aβ) (10-20 μM) significantly decreased the fragments of Dil+ACs fragments phagocytized by BMDMs in a concentration-dependent manner.

    β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374.  [Abstract]

    Low-dose (1 μM) β-Amyloid (1-42), (rat/mouse) (Aβ) (1-15 μM) had a protective effect on cell survival, whereas 5 μM, 10 μM, and 15 μM Aβ significantly increased the apoptosis of ECs.

    β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374.  [Abstract]

    β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) caused a higher quantity of small punctate and rounded mitochondria with aberrant morphology in ECs compared with the control group.

    β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374.  [Abstract]

    Dynamin-related protein 1 (Drp1) expression level ascertained that β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) exerted an accelerative effect on mitochondrial fission by promoting the translocation of Drp1 from cytoplasm to mitochondria.

    β-Amyloid (1-42), (rat/mouse) TFA purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374.  [Abstract]

    β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) resulted in shortened and less interconnected mitochondrial structures in ECs.
    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

    IC50 & Target

    Amyloid-β[1]

    In Vitro

    β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
    1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
    2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 °C.
    3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
    4. Next, the solution was aged 48h at 4-8 °C. The sample was then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
    Methods vary depends on the downstream applications.

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    In Vivo

    Note:
    Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

    β-Amyloid (1-42), (rat/mouse) (TFA) can induce Alzheimer's disease[4].

    Induction of Alzheimer's disease[4]
    Background
    Alzheimer’s disease (AD) is a progressive neurodegenerative disorder mainly characterized by the abnormal accumulation of β-amyloid (Aβ) peptide. The oligomeric form of the Aβ peptide as being the critical initiator of neurotoxicity in the AD pathogenesis[4].
    Specific Modeling Methods
    Rat: Wistar • male • adult, weighing 240-260 g
    Administration: 1 μg/μL • Hippocampal injection • single dose
    Note
    (1) β-Amyloid (1-42) TFA needs to be processed into oligomers before use.
    (2) β-Amyloid (1-42) TFA was injected bilaterally into the hippocampus of rat brain in a volume of 1.0 μL over a period of 0.1 μL/min using 1 μL Hamilton syringe.
    Modeling Indicators
    Indicator changes: Decreased the gene expression level of α7-nAChR and increased the mRNA expression of NMDA receptor 2A, and -2B subunits.
    Behavior: β-Amyloid (1-42) TFA aggregates increased the retention time and altered the behavioral response in rats after 15 days of injection.
    Correlated Product(s): β-Amyloid (1-42), (rat/mouse) (HY-P1388); β-Amyloid (1-40) (rat) (HY-P1387);
    β-Amyloid (1-40) TFA (HY-P0265A)

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Molecular Weight

    4418.02 (free acid)

    Formula

    C199H307N53O59S.xC2HF3O2

    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

    Sequence Shortening

    DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *The compound is unstable in solutions, freshly prepared is recommended.

    Solvent & Solubility
    In Vitro: 

    DMSO : 50 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    Purity & Documentation
    References
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    β-Amyloid (1-42), (rat/mouse) TFA
    Cat. No.:
    HY-P1388A
    Quantity:
    MCE Japan Authorized Agent: