β-Amyloid (1-42), (rat/mouse) (Synonyms: Amyloid β-peptide (1-42) (rat/mouse))

Name: β-Amyloid (1-42), (rat/mouse)
Brand: MedChemExpress
SKU: HY-P1388
Rating: 5.0 (8 reviews)

Cat. No.: HY-P1388 Purity: 96.71%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

β-Amyloid (1-42), (rat/mouse) is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 166090-74-0

Size	Stock	Quantity
500 μg	In-stock	Estimated Time of Arrival: December 31
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 8 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-42), (rat/mouse):

β-Amyloid (1-42), (rat/mouse) TFA In-stock

8 Publications Citing Use of MCE β-Amyloid (1-42), (rat/mouse)

Flow Cytometry

Cell Imaging/Staining

: β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]; β-Amyloid (1-42), (rat/mouse) (Aβ) (10-20 μM) significantly decreased the fragments of Dil+ACs fragments phagocytized by BMDMs in a concentration-dependent manner.

: β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]; Low-dose (1 μM) β-Amyloid (1-42), (rat/mouse) (Aβ) (1-15 μM) had a protective effect on cell survival, whereas 5 μM, 10 μM, and 15 μM Aβ significantly increased the apoptosis of ECs.

: β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]; β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) caused a higher quantity of small punctate and rounded mitochondria with aberrant morphology in ECs compared with the control group.

: β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]; Dynamin-related protein 1 (Drp1) expression level ascertained that β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) exerted an accelerative effect on mitochondrial fission by promoting the translocation of Drp1 from cytoplasm to mitochondria.

: β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]; β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) resulted in shortened and less interconnected mitochondrial structures in ECs.

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

β-Amyloid (1-42), (rat/mouse) is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

IC₅₀ & Target

Amyloid-β^[1]

In Vitro

β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs). 1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure. 2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 °C. 3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing. 4. Next, the solution was aged 48h at 4-8 °C. The sample was then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments. Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

β-Amyloid (1-42), (rat/mouse) can induce Alzheimer's disease^[4].

Induction of Alzheimer's disease^[4]

Background

Alzheimer’s disease (AD) is a progressive neurodegenerative disorder mainly characterized by the abnormal accumulation of β-amyloid (Aβ) peptide. The oligomeric form of the Aβ peptide as being the critical initiator of neurotoxicity in the AD pathogenesis^[4].

Specific Modeling Methods

Rat: Wistar • male • adult, weighing 240-260 g
Administration: 1 μg/μL • Hippocampal injection • single dose

Note

(1) β-Amyloid (1-42) needs to be processed into oligomers before use.
(2) β-Amyloid (1-42) was injected bilaterally into the hippocampus of rat brain in a volume of 1.0 μL over a period of 0.1 μL/min using 1 μL Hamilton syringe.

Modeling Indicators

Indicator changes: Decreased the gene expression level of α7-nAChR and increased the mRNA expression of NMDA receptor 2A, and -2B subunits.
Behavior: β-Amyloid (1-42) aggregates increased the retention time and altered the behavioral response in rats after 15 days of injection.

Correlated Product(s): β-Amyloid (1-42), (rat/mouse) TFA (HY-P1388A); β-Amyloid (1-40) (rat) (HY-P1387); β-Amyloid (1-40) TFA (HY-P0265A)

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4418.02

Formula

C₁₉₉H₃₀₇N₅₃O₅₉S

CAS No.

166090-74-0

Appearance

Solid

Color

White to off-white

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Solvent & Solubility

In Vitro:

DMSO : 25 mg/mL (5.66 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2263 mL	1.1317 mL	2.2635 mL
5 mM	0.0453 mL	0.2263 mL	0.4527 mL
10 mM	---	---	---

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo:

Select the appropriate dissolution method based on your experimental animal and administration route.

For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for in vivo experiments, it is recommended to prepare freshly and use it on the same day.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: 10% DMSO 90% (20% SBE-β-CD in Saline)
Solubility: 2.5 mg/mL (0.57 mM); Suspended solution; Need ultrasonic

This protocol yields a suspended solution of 2.5 mg/mL. Suspended solution can be used for oral and intraperitoneal injection.
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
Protocol 2

Add each solvent one by one: 10% DMSO 90% Corn Oil
Solubility: ≥ 2.5 mg/mL (0.57 mM); Clear solution

This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown). If the continuous dosing period exceeds half a month, please choose this protocol carefully.
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL Corn oil, and mix evenly.

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Please enter your animal formula composition:

DMSO +

Tween-80 +

Saline

Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.

The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).

Calculation results:

Working solution concentration: mg/mL

Method for preparing stock solution: mg drug dissolved in μL DMSO (Stock solution concentration: mg/mL).

*The compound is unstable in solutions, freshly prepared is recommended.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only. If necessary, please contact MedChemExpress (MCE).

Method for preparing in vivo working solution for animal experiments: Take μL DMSO stock solution, add μL . μL , mix evenly, next add μL Tween 80, mix evenly, then add μL Saline.

If the continuous dosing period exceeds half a month, please choose this protocol carefully.

Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.

Purity & Documentation

Purity: 98.87%

Select Batch:

Data Sheet (296 KB) SDS (252 KB)

COA (268 KB) RP-HPLC (208 KB) MS (71 KB)

Handling Instructions (2659 KB)

References

[1]. Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5. [Content Brief]

[2]. Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34. [Content Brief]

[3]. Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94. [Content Brief]

[4]. Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42)-induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41(2):139-150. [Content Brief]

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2263 mL	1.1317 mL	2.2635 mL	5.6586 mL
DMSO	5 mM	0.0453 mL	0.2263 mL	0.4527 mL	1.1317 mL

β-Amyloid (1-42), (rat/mouse) Related Classifications

Neurological Disease

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

β-Amyloid (1-42), (rat/mouse)166090-74-0Amyloid β-peptide (1-42) (rat/mouse)Amyloid-ββ-amyloid peptideAβAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

β-Amyloid (1-42), (rat/mouse) (Synonyms: Amyloid β-peptide (1-42) (rat/mouse))

Customer Review

Other Forms of β-Amyloid (1-42), (rat/mouse):

β-Amyloid (1-42), (rat/mouse) Related Antibodies

8 Publications Citing Use of MCE β-Amyloid (1-42), (rat/mouse)

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review

β-Amyloid (1-42), (rat/mouse) Related Antibodies

Molarity Calculator

Dilution Calculator

Complete Stock Solution Preparation Table

β-Amyloid (1-42), (rat/mouse) Related Classifications

Keywords:

Your Recently Viewed Products:

Customer Review

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report