1. Neuronal Signaling
  2. Amyloid-β
  3. β-Amyloid (1-42), rat

β-Amyloid (1-42), rat (Synonyms: Amyloid β-peptide (1-42) (rat))

Cat. No.: HY-P1388
Handling Instructions

β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-42), rat Chemical Structure

β-Amyloid (1-42), rat Chemical Structure

CAS No. : 166090-74-0

Size Price Stock
500 μg USD 200 Get quote
1 mg USD 320 Get quote
5 mg USD 1200 Get quote

* Please select Quantity before adding items.

Other In-stock Forms of β-Amyloid (1-42), rat:

Other Forms of β-Amyloid (1-42), rat:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

IC50 & Target

Amyloid-β[1]

In Vitro

β-Amyloid (1-42), rat shows cytotoxic effect on the hippocampal slices at 20 μM[1]. β-Amyloid (1-42), rat causes morphological changes in NGF-induced PC12 cells, induces formed cell processes to retract in differentiated cells and affect the expression of exons 2/3 in both undifferentiated and differentiated cells[2].

Molecular Weight

4418.02

Formula

C₁₉₉H₃₀₇N₅₃O₅₉S

CAS No.

166090-74-0

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
Cell Assay
[1]

After treating the hippocampal slices with 20 μM β-Amyloid (1-42) for 4 h, supernatant is replaced by fresh H-ASCF/3 (0.9 mL/chamber) to which 0.1 mL MTT stock solution (5 mg/mL H-ACSF/3) is added (MTT final concentration: 0.5 mg/mL). The chamber is left to rest for 15 min without carboxygenation. To stop further reduction of MTT, the medium (H-ACSF/3) is removed. The slices are transferred into 96-well plate, then pure DMSO (100 μL/slice/well) is added for dissolving formazane from the slices. (30 min in a 96-well plate). Then 70 μL DMSO solution from each slice (well) is transferred into another 96-well plate. The optical density (OD) of the dissolved formazane is measured at 550 and 620 nm[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-42), rat
Cat. No.:
HY-P1388
Quantity: