1. Recombinant Proteins
  2. Carbonic Anhydrase 14 Protein, Human (His)

Carbonic Anhydrase 14 Protein, Human (His)

Cat. No.: HY-P7727
Handling Instructions

Carbonic Anhydrase 14 Protein, Human (His) is an approximately 40.0 kDa human carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCarbonic Anhydrase 14, His; Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA14;
Species

Human

Source

E. coli

Accession

Q9ULX7 (G19-M290)

Gene ID

23632

Molecular Weight

Approximately 40.0 kDa

AA Sequence

HHHHHHGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 150 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Carbonic AnHYdrase XIV is a type I membrane enzyme highly expressed in all parts of the central nervous system. And it exhibits lower expression in adult liver, heart, kidney, urinary bladder, and skeletal muscle[1].
The carbonic anhydrasekl (CA) family consists of at least 11 enzymatically active members and a few inactive homologous proteins[2].
The carbonic anhydrases are indentified as metalloenzyme for its zinc ion prosthetic group, it can catalyze the rapid interconversion of carbon dioxide and water to bicarbonate and protons. They also take part in maintaining acid-base balance in blood and other tissues[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 14 Protein, Human (His)
Cat. No.:
HY-P7727
Quantity:
MCE Japan Authorized Agent: