Carbonic Anhydrase 10 Protein, Human (His)
Carbonic Anhydrase 10 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 10 is an inactive isoform of carbonic anhydrase (CAs).
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Carbonic Anhydrase 10 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 10 is an inactive isoform of carbonic anhydrase (CAs)[1].
Background
The catalytically inactive isoforms of carbonic anhydrase (CAs) are known as CA-related proteins (CARPs) VIII, X, and XI. They have highly conserved amino acid sequences. CARP X is more highly expressed in the pineal gland during night compared to the day time, suggesting a function for wake/sleep patterns[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9NS85-1 (A21-N300)
-
Molecular Construction
-
N-term
-
CA10 (A21-N300)
Accession # Q9NS85-1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CA10; Carbonic Anhydrase-Related Protein X; Carbonic Anhydrase 10 (Inactive); Carbonic Anhydrase X; Carbonic Anhydrase-Related Protein 10; CA-RP X; Carbonic Anhydrase 10; CARP X; HUCEP-15; Epididymis Secretory Sperm Binding Protein; CA-RPX; Cerebral Prote
-
AA Sequence
AQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN
-
Predicted Molecular Mass
33 kDa
-
Molecular Weight
Approximately 31 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
