Carbonic Anhydrase 8 Protein, Human (His)
Carbonic Anhydrase VIII/CA8 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 8 (CA8), an isozyme of α-carbonic anhydrases (CAs), is an allosteric inhibitor of inositol trisphosphate receptor-1 (ITPR1), which regulates neuronal intracellular calcium release.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Carbonic Anhydrase VIII/CA8 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 8 (CA8), an isozyme of α-carbonic anhydrases (CAs), is an allosteric inhibitor of inositol trisphosphate receptor-1 (ITPR1), which regulates neuronal intracellular calcium release[1][2].
Background
CA8 overexpression desensitizes neuronal cells to STS induced apoptotic stress and increases cell migration and invasion ability in neuronal cells. In addition, down-regulated CA8 decreases neuron mobility in neuronal cells and leads to abnormal calcium release in cerebellar granule neurons. Knockdown of the ca8 gene results in an abnormal movement pattern in zebrafish[2].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P35219 (A2-Q290)
-
Molecular Construction
-
N-term
-
CA8 (A2-Q290)
Accession # P35219 -
6*His
-
C-term
-
-
Protein Length
Full Length of Beta-tectorinChain
-
Synonyms
CA8; Carbonic Anhydrase-Related Protein; Prev. CALS; Carbonic Anhydrase-Like Sequence; CA-VIII; Carbonate Dehydratase; CARP; CA-Related Protein; Carbonic Anhydrase VIII; CAMRQ3; CA-RP; SCAR34; Carbonic Anhydrase 8 (Inactive); Carbonic Anhydrase 8
-
AA Sequence
ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
-
Predicted Molecular Mass
34 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Gerald Z Zhuang, et al. Human carbonic anhydrase-8 AAV8 gene therapy inhibits nerve growth factor signaling producing prolonged analgesia and anti-hyperalgesia in mice. Gene Ther. 2018 Jul;25(4):297-311. [Content Brief]
[2]. Min-Syuan Huang, et al. Roles of carbonic anhydrase 8 in neuronal cells and zebrafish. Biochim Biophys Acta. 2014 Sep;1840(9):2829-42. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
