Carbonic Anhydrase 1 Protein, Human (His)
Based on 1 Customer Validation
Carbonic Anhydrase 1 Protein, Human (His) is the recombinant human-derived Carbonic Anhydrase 1, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Carbonic Anhydrase 1 Protein, Human (His) is the recombinant human-derived Carbonic Anhydrase 1, expressed by E. coli , with C-6*His labeled tag.
Background
CA I is a carbonic anhydrase that catalyzes the reversible hydration of carbon dioxide. It can also hydrate cyanamide to urea.
Verified Bioactivity
Measured by its esterase activity. The specific activity is >24 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Assay Procedure
Materials
Assay buffer: 12.5 mM Tris, 75 mM NaCl, pH 7.5
Test protein: Carbonic Anhydrase 1 Protein, Human (His) (HY-P7718A)
Substrate: 4-Nitrophenylacetate (4-NPA), prepared as a 20 mM stock solution in ethanol
Procedure
1. Dilute Human CA1 to 100 ng/μL in assay buffer.
2. Dilute substrate to 2 mM in assay buffer.
3. Add 50 μL of 100 ng/μL Human CA1 to the well plate, followed by 50 μL of 2 mM substrate to initiate the reaction. Perform triplicate wells.
4. Include a substrate blank containing 50 μL assay buffer and 50 μL substrate. Perform triplicate wells.
5. Read at 400 nm wavelength for 5 minutes in kinetic mode.
6. Calculate specific activity:
Specific Activity (pmol/min/μg) = | Adjusted Vmax* (OD/min) x Conversion Factor ** (pmol/OD) |
| amount of enzyme (μg) |
*Adjusted for Control
**Derived using calibration standard
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P00915 (A2-F261)
-
Gene ID759
-
Protein Length
Full Length
-
Synonyms
CA1; CA-I; Carbonic Anhydrase 1; CAB; Carbonic Anhydrase I; Epididymis Secretory Sperm Binding Protein; Cyanamide Hydratase CA1; Epididymis Secretory Protein Li 11; Carbonate Dehydratase I; Carbonic Anhydrase; Car1; HEL-S-11; Carbonic Anhydrase B
-
AA Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
-
Predicted Molecular Mass
28.7 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 20% glycerol.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol, 0.02% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
