1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. Carbonic Anhydrase 1 Protein, Human (His)

Carbonic Anhydrase 1 Protein, Human (His) is the recombinant human-derived Carbonic Anhydrase 1, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carbonic Anhydrase 1 Protein, Human (His) is the recombinant human-derived Carbonic Anhydrase 1, expressed by E. coli , with C-6*His labeled tag.

Background

CA I is a carbonic anhydrase that catalyzes the reversible hydration of carbon dioxide. It can also hydrate cyanamide to urea.

Biological Activity

Measured by its esterase activity. The specific activity is >24 pmol/min/μg.

Assay Procedure

Materials
Assay buffer: 12.5 mM Tris, 75 mM NaCl, pH 7.5
Test protein: Carbonic Anhydrase 1 Protein, Human (His) (HY-P7718A)
Substrate: 4-Nitrophenylacetate (4-NPA), prepared as a 20 mM stock solution in ethanol

Procedure
1. Dilute Human CA1 to 100 ng/μL in assay buffer.
2. Dilute substrate to 2 mM in assay buffer.
3. Add 50 μL of 100 ng/μL Human CA1 to the well plate, followed by 50 μL of 2 mM substrate to initiate the reaction. Perform triplicate wells.
4. Include a substrate blank containing 50 μL assay buffer and 50 μL substrate. Perform triplicate wells.
5. Read at 400 nm wavelength for 5 minutes in kinetic mode.
6. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (OD/min) x Conversion Factor ** (pmol/OD)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P00915 (A2-F261)

Gene ID

759

Protein Length

Full Length of Mature Protein

Synonyms
rHuCarbonic Anhydrase 1, His; Carbonic Anhydrase 1; Carbonate Dehydratase I; Carbonic Anhydrase B; CAB; Carbonic Anhydrase I; CA1
AA Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Molecular Weight

Approximately 29 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 20% glycerol.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol, 0.02% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Carbonic Anhydrase 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Carbonic Anhydrase 1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 1 Protein, Human (His)
Cat. No.:
HY-P7718A
Quantity:
MCE Japan Authorized Agent: