1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL16
  6. HCC-4/CCL16 Protein, Human (CHO)

HCC-4/CCL16 Protein, Human (CHO)

Cat. No.: HY-P7196
COA Handling Instructions

HCC-4/CCL16 Protein, Human (CHO) is a CC chemokine that specifically attracts lymphocytes, dendritic cells and monocytes, increases their adhesion and has myelosuppressive activity. HCC-4/CCL16 Protein, Human (CHO) interacts with CCR1, CCR2, CCR5 and CCR8 to mediate inflammatory and cancer responses. HCC-4/CCL16 Protein, Human (CHO) is a recombinant human HCC-4/CCL16 (Q24-Q120) expressed by CHO.

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $420 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

HCC-4/CCL16 Protein, Human (CHO) is a CC chemokine that specifically attracts lymphocytes, dendritic cells and monocytes, increases their adhesion and has myelosuppressive activity. HCC-4/CCL16 Protein, Human (CHO) interacts with CCR1, CCR2, CCR5 and CCR8 to mediate inflammatory and cancer responses. HCC-4/CCL16 Protein, Human (CHO) is a recombinant human HCC-4/CCL16 (Q24-Q120) expressed by CHO[1].

Background

CCL16, also known as CC chemokine 4, liver expressed chemokine (LEC) and monotactin-1 (MTN-1), is a small cytokine belonging to the CC chemokine family, a cluster of chemokines located on human chromosome 17. CCL16 is also a ligand for the histamine H4 receptor. CCL16 can chemotacticize monocytes and lymphocytes but not neutrophils. Recent studies have shown that CCL16 increases tumor rejection, antigen presentation by macrophages, and angiogenic activity of vascular endothelial cells. On the other hand, CCL16 may also enhance the anticancer effects of cytotoxic T cells and dendritic cell (DC) lymphocytes[1][2].

In Vitro

CCL16 expression is upregulated in LPS-induced WI-38 cells, and CCL16 silencing inhibits LPS-induced apoptosis and inflammation in human lung fibroblast line WI-38 cells[2].
HCC-4/CCL16 (1-3000 ng/mL, 12 h) induces maximal chemotactic activity in CCR1-expressing HOS cells at a concentration of 1000ng/mL, transducing chemotactic signals via G i / Go proteins, PLC and PKCδ. It also activates the p38 MAPK signaling pathway in a time- and dose-dependent manner but with no effect on Ca2+ mobilization[3].

Biological Activity

The ED50 is <1.5 μg/mL as measured by CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells).

Species

Human

Source

CHO

Tag

Tag Free

Accession

O15467 (Q24-Q120)

Gene ID
Synonyms
rHuHCC-4/CCL16; C-C motif chemokine 16; SCYA16
AA Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

HCC-4/CCL16 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCC-4/CCL16 Protein, Human (CHO)
Cat. No.:
HY-P7196
Quantity:
MCE Japan Authorized Agent: