mip+1+beta

By Targets:	CCR (3) Cholinesterase (ChE) (1) Endogenous Metabolite (1) Interleukin Related (2) NF-κB (2) NOD-like Receptor (NLR) (2) Small Interfering RNA (siRNA) (2) Toll-like Receptor (TLR) (2)
By Research Areas:	Cancer (1) Endocrinology (1) Inflammation/Immunology (5) Metabolic Disease (2) Neurological Disease (1)
Oligonucleotides:	Human Pre-designed siRNA Sets (2) siRNAs (2)

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-B0498

Bindarit 25+ Cited Publications AF2838	CCR	Neurological Disease Inflammation/Immunology Endocrinology Cancer
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins *MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4*, MIP-3/CCL23. Bindarit also has anti-inflammatory activity ^[1].

HY-P5523A

iE-DAP dihydrochloride	NOD-like Receptor (NLR) NF-κB Interleukin Related	Metabolic Disease
iE-DAP dihydrochloride is a *Nod1* agonist. iE-DAP dihydrochloride activates *NOD1, which in turn activates the NF-κB* signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP dihydrochloride downregulates the expression of *ZO-1* and Occludin genes. iE-DAP dihydrochloride increases the secretion of IL-6, GRO-α, *MCP-1, IL-8* and *MIP-1β* in term human trophoblast cell cultures. iE-DAP dihydrochloride triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP dihydrochloride can be used in studies related to mastitis and preterm birth ^[1] .

HY-P4191A

Met-RANTES (human) acetate	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-P5189A

*His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA*	Endogenous Metabolite Cholinesterase (ChE)	Others
His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA, is a growth hormone releasing peptide, as well as a metabolite of GHRP-1. GHRP-1, or Ala-His-D-beta Nal-Ala-Trp-D-Phe-Lys-NH2, has the effect of promoting the release of growth hormone (GH). GHRP-1 increases GH release and increases [Ca2+]i levels in static monolayer cells of rat pituitary gland, but does not affect cAMP levels ^[1].

HY-P5523

iE-DAP	NOD-like Receptor (NLR) NF-κB Interleukin Related	Metabolic Disease
iE-DAP is a *Nod1* agonist. iE-DAP activates *NOD1, which in turn activates the NF-κB signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP downregulates the expression of ZO-1* and Occludin genes. iE-DAP increases the secretion of IL-6, GRO-α, *MCP-1, IL-8* and *MIP-1β* in term human trophoblast cell cultures. iE-DAP triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP is applicable to research related to mastitis and preterm birth ^[1] .

HY-149650

TLR4 agonist-1	Toll-like Receptor (TLR)	Inflammation/Immunology
TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of *MIP-1β* in RAW 264.7 and MM6 cells ^[1].

HY-149650A

TLR4 agonist-1 TEA	Toll-like Receptor (TLR)	Inflammation/Immunology
TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of *MIP-1β* in RAW 264.7 and MM6 cells ^[1].

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-RS02103

CCL4L1 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
CCL4L1 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL4L1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

CCL4L1 Human Pre-designed siRNA Set A CCL4L1 Human Pre-designed siRNA Set A

HY-RS02102

CCL4 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
CCL4 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL4 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

CCL4 Human Pre-designed siRNA Set A CCL4 Human Pre-designed siRNA Set A

Cat. No.	Product Name	Target	Research Area

HY-P5523A

iE-DAP dihydrochloride	NOD-like Receptor (NLR) NF-κB Interleukin Related	Metabolic Disease
iE-DAP dihydrochloride is a *Nod1* agonist. iE-DAP dihydrochloride activates *NOD1, which in turn activates the NF-κB* signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP dihydrochloride downregulates the expression of *ZO-1* and Occludin genes. iE-DAP dihydrochloride increases the secretion of IL-6, GRO-α, *MCP-1, IL-8* and *MIP-1β* in term human trophoblast cell cultures. iE-DAP dihydrochloride triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP dihydrochloride can be used in studies related to mastitis and preterm birth ^[1] .

HY-P4191A

Met-RANTES (human) acetate	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-P5189A

*His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA*	Endogenous Metabolite Cholinesterase (ChE)	Others
His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA, is a growth hormone releasing peptide, as well as a metabolite of GHRP-1. GHRP-1, or Ala-His-D-beta Nal-Ala-Trp-D-Phe-Lys-NH2, has the effect of promoting the release of growth hormone (GH). GHRP-1 increases GH release and increases [Ca2+]i levels in static monolayer cells of rat pituitary gland, but does not affect cAMP levels ^[1].

HY-P5523

iE-DAP	NOD-like Receptor (NLR) NF-κB Interleukin Related	Metabolic Disease
iE-DAP is a *Nod1* agonist. iE-DAP activates *NOD1, which in turn activates the NF-κB signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP downregulates the expression of ZO-1* and Occludin genes. iE-DAP increases the secretion of IL-6, GRO-α, *MCP-1, IL-8* and *MIP-1β* in term human trophoblast cell cultures. iE-DAP triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP is applicable to research related to mastitis and preterm birth ^[1] .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-B0498

Bindarit 25+ Cited Publications AF2838	Neurological Disease Classification of Application Fields Ketones, Aldehydes, Acids Umbelliferae Plants Disease Research Fields Echinacea angustifolia DC. Endocrinology Source Classification Cancer	CCR
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins *MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4*, MIP-3/CCL23. Bindarit also has anti-inflammatory activity ^[1].

Species:	Human (2) Mouse (2) Rat (1)
Tag:	His (2) Tag Free (3)
Source:	P. pastoris (1) E. coli (4)

Cat. No.	Compare	Product Name	Species	Source	Image

HY-P71899

	CCL4 Protein, Rat Ccl4; Mip1b; Scya4C-C motif chemokine 4; Macrophage inflammatory protein 1-beta; MIP-1-beta; Small-inducible cytokine A4	Rat	E. coli
	CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free.

HY-P71889

	CCL4 Protein, Mouse Ccl4; Mip1b; Scya4; C-C motif chemokine 4; Immune activation protein 2; ACT-2; ACT2; Macrophage inflammatory protein 1-beta; MIP-1-beta; Protein H400; SIS-gamma; Small-inducible cytokine A4	Mouse	E. coli
	CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.CCL4 Protein, Mouse is the recombinant mouse-derived CCL4 protein, expressed by E.coli , with tag free.

HY-P700165AF

	Animal-Free CCL4 Protein, Mouse (His) Ccl4; Mip1b; Scya4; C-C motif chemokine 4; Immune activation protein 2; ACT-2; ACT2; Macrophage inflammatory protein 1-beta; MIP-1-beta; Protein H400; SIS-gamma; Small-inducible cytokine A4	Mouse	E. coli
	CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

HY-P74342

	CCL4 Protein, Human (P.pastoris, His) MIP-1β/CCL4; C-C motif chemokine 4; LAG-1; SCYA4	Human	P. pastoris
	CCL4 Protein, Human (P.pastoris, His) is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human (P.pastoris, His) is a recombinant human CCL4 (A24-Q92) expressed by P. pastoris with a His tag at the C-terminu.

HY-P701233

	LAG-1/CCL4L1 Protein, Human CCL4L1; chemokine (C-C motif) ligand 4-like 1; CCL4L, chemokine (C C motif) ligand 4 like, SCYA4L, small inducible cytokine A4 like; C-C motif chemokine 4-like; AT744.2; LAG 1; MIP-1-beta; macrophage inflammatory protein-1b2; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; monocyte adherence-induced protein 5-alpha; LAG1; CCL4L; LAG-1; SCYA4L;	Human	E. coli
	LAG-1/CCL4L1 protein acts as a chemokine and can induce chemotaxis in cells expressing CCR5 or CCR1, indicating its role in cell migration (chemotaxis). Furthermore, it demonstrated the ability to inhibit HIV replication, particularly in CCR5-expressing peripheral blood mononuclear cells, suggesting a potential impact on antiviral defense mechanisms. LAG-1/CCL4L1 Protein, Human is the recombinant human-derived LAG-1/CCL4L1 protein, expressed by E. coli , with tag free.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Compare	Product Name	Application	Reactivity	Image

HY-P82814

	*CCL4 beta* Antibody (YA2559)** ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta	WB, ICC/IF, IP	Human, Mouse
	CCL4 beta Antibody (YA2559) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to CCL4 beta.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name		Classification

HY-RS02103

CCL4L1 Human Pre-designed siRNA Set A		siRNAs Human Pre-designed siRNA Sets
CCL4L1 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL4L1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

HY-RS02102

CCL4 Human Pre-designed siRNA Set A		siRNAs Human Pre-designed siRNA Sets
CCL4 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL4 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Peptides

Natural
Products

Recombinant Proteins

Antibodies

Oligonucleotides

Name
Email *

	Sorry, but the email address you supplied was invalid.

mip+1+beta

Inhibitors & Agonists

Peptides

NaturalProducts

Recombinant Proteins

Antibodies

Oligonucleotides

Natural
Products