CCL4 Protein, Mouse
Based on 1 publication(s) in Google Scholar
CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.CCL4 Protein, Mouse is the recombinant mouse-derived CCL4 protein, expressed by E.coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.CCL4 Protein, Mouse is the recombinant mouse-derived CCL4 protein, expressed by E.coli , with tag free.
CCL4 protein, characterized by its inflammatory and chemokinetic properties, functions as a monokine and forms homodimers.
1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 20-100 ng/mL.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 5.030 ng/mL, corresponding to a specific activity is 1.988×105 U/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Mol Immunol
USP21 drives immune evasion in colorectal cancer via deubiquitination and stabilization of β-catenin. [Abstract]2026 Jun;23(6):701-718. PMID: 42091690
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P14097 (A24-N92)
-
Molecular Construction
-
N-term
-
CCL4 (A24-N92)
Accession # P14097 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Ccl4; Mip1b; Scya4; C-C motif chemokine 4; Immune activation protein 2; ACT-2; ACT2; Macrophage inflammatory protein 1-beta; MIP-1-beta; Protein H400; SIS-gamma; Small-inducible cytokine A4
-
AA Sequence
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
-
Predicted Molecular Mass
7.8 kDa
-
Molecular Weight
Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (259 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
