GCGR

Glucagon Receptor

GCGR

Related Products

GCGR (glucagon receptor) is in the G protein-coupled receptor family, that is important in controlling blood glucose levels. The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to G alpha i, Gs and to a lesser extent G alpha q. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP. In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney with lesser amounts found in heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.

GCGR Related Products (140)
Recombinant Proteins (4)

By Effects:	Inhibitors (5) Agonists (77) Antagonists (21) Modulators (8)

Cat. No.	Product Name	Effect	Purity	Chemical Structure

HY-50675

GRA Ex-25	Inhibitor	98.59%
GRA Ex-25 is an inhibitor of glucagon receptor, with IC₅₀ of 56 and 55 nM for rat and human glucagon receptors, respectively.

HY-P4146A

Survodutide TFA	Agonist	99.62%
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC₅₀s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake.

HY-144035

GLP-1R agonist 4	Agonist	98.26%
GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96).

HY-P99383

Volagidemab	Antagonist	98.43%
Volagidemab is an antagonistic glucagon receptor (GCGR) monoclonal antibody (mAb). Volagidemab can be used in the research of type 1 diabetes (T1D).

HY-P1160

Bay 55-9837	Agonist	99.08%
Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a K_d of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.

HY-144034

GLP-1R agonist 3	Agonist	99.15%
GLP-1R agonist 3 is a potent agonist of GLP-1R. GLP-1R agonist 3 is a thickened imidazole derivative compound. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 3 has the potential for the research of diabetes (extracted from patent WO2021197464A1, compound 1).

HY-148844

GCGR antagonist 2	Antagonist	99.76%
GCGR antagonist 2, a Furan-2-carbohydrazide, is an orally active glucagon receptor antagonist. GCGR antagonist 2 binds to hGluR with an K_d value of 2.3 nM, and inhibits rat receptor with an IC₅₀ value of 0.43 nM. GCGR antagonist 2 inhibits glucagon-stimulated glycogenolysis.

HY-10036

Glucagon receptor antagonists-1	Antagonist	98.65%
Glucagon receptor antagonists-1 is a highly potent glucagon receptor antagonist.

HY-148212

GLP-1R agonist 17	Agonist
GLP-1R agonist 17 is a GLP-1 receptor agonist. GLP-1R agonist 17 shows excellent agonism on a GLP-1 receptor. GLP-1R agonist 17 can be used for the research of cardiovascular metabolic diseases.

HY-P10018

Bamadutide	Agonist	99.96%
Bamadutide (SAR425899) is a potent dual glucagon-like peptide-1 receptor/glucagon receptor agonist. Bamadutide (SAR425899) improves postprandial glucose control by significantly enhancing β-cell function and slowing glucose absorption rate in vivo. Bamadutide (SAR425899)can be used for type 2 diabetes research.

HY-145412

GLP-1 receptor agonist 7		98.41%
GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 (GLP-1). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b).

HY-116819

VU0453379	Modulator	≥98.0%
VU0453379 is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC₅₀ of 1.3 μM.

HY-P2497

Exendin (5-39)	Antagonist	99.81%
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.

HY-P1231

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS		99.03%
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

HY-P1226

HAEGTFTSD	Agonist	98.48%
HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner

HY-P1224

HAEGTFTSDVS		98.31%
HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.

HY-119739

Skyrin	Antagonist
Skyrin is an anthraquinone compound that can be isolated from almond fruit. Skyrin is a receptor-selective glucagon antagonist. Skyrin can inhibit the growth of tumor cells.

HY-147622

GLP-1R agonist 9	Agonist
GLP-1R agonist 9 (Compound 96) is a GLP-1R agonist with EC₅₀ values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and CHO GLP-1R Clone C6, respectively.

HY-P3622

(Ser8)-GLP-1 (7-36) amide, human	Agonist
(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.

HY-P0054A

GLP-1(7-36), amide	Agonist
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

Name
Email *

	Sorry, but the email address you supplied was invalid.

GCGR

GCGR

GCGR Related Products (140)

Recombinant Proteins (4)

GCGR Related Products (140):