B7-33 

B7-33 is a single-chain relaxin mimetic and a selective relaxin receptor 1 (RXFP1) agonist. B7-33 phosphorylates ERK1/2 without inducing activation of the cAMP signaling pathway. B7-33 exhibits anti-fibrotic and cardioprotective activities. B7-33 can be used in the research of vascular diseases such as cardiomyopathy, myocardial infarction and fibrosis^[1][2].

B7-33 (10-100 nM) increases the survival rate of primary adult mouse cardiomyocytes subjected to simulated ischemia-reperfusion treatment via an ERK 1/2-dependent mechanism^[1].
B7-33 (10-100 nM; 12 h) increases the survival rate of primary adult mouse cardiac fibroblasts subjected to simulated ischemia-reperfusion^[1].
B7-33 (10-100 nM) dose-dependently increases the phosphorylation level of ERK1/2 in primary cardiomyocytes of adult mice^[1].
B7-33 (100 nM; 24 h) reduces the expression of inflammasome marker ASC and endoplasmic reticulum stress marker GRP78 in adult primary mouse cardiomyocytes subjected to simulated ischemia-reperfusion^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

B7-33 (0.25 mg/kg; i.p.; twice daily; 7 days) exerts a protective effect in a mouse model of ischemia-reperfusion^[1].
B7-33 (0.25 mg/kg; s.c.; 7 days) exerts cardioprotective effects in a mouse model of cardiomyopathy^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

2986.54

C₁₃₁H₂₂₉N₄₁O₃₆S

1818415-56-3

Solid

white

Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH2

VIKLSGRELVRAQIAISGMSTWSKRSL-NH2

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Devarakonda T, et al. B7-33, a Functionally Selective Relaxin Receptor 1 Agonist, Attenuates Myocardial Infarction-Related Adverse Cardiac Remodeling in Mice. J Am Heart Assoc. 2020;9(8):e015748.  [Content Brief]

  [2]. Alam F, et al. The single-chain relaxin mimetic, B7-33, maintains the cardioprotective effects of relaxin and more rapidly reduces left ventricular fibrosis compared to perindopril in an experimental model of cardiomyopathy. Biomed Pharmacother. 2023;160:114370.  [Content Brief]