CART (1-39), Human 

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior^[1].

CART (1-39), Human, Rat (100 nM) increases intracellular calcium concentrations in rat cortical neurons^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

CART (1-39), Human, Rat (0.05-2 nM; Intrathecal injection; Sprague-Dawley rats) can not cause a significant change of blood pressure or heart rate, but potentiates the pressor effects of glutamate injected intrathecally in anesthetized rats^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4406.85

C₁₉₃H₃₁₄N₅₀O₆₇

Solid

White to light yellow

{Glp}-Glu-Asp-Ala-Glu-Leu-Gln-Pro-Arg-Ala-Leu-Asp-Ile-Tyr-Ser-Ala-Val-Asp-Asp-Ala-Ser-His-Glu-Lys-Glu-Leu-Ile-Glu-Ala-Leu-Gln-Glu-Val-Leu-Lys-Lys-Leu-Lys-Ser

{Glp}-EDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKS

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

• [1]. Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide(1-39) in the rat. Regul Pept. 2007 Apr 5;140(1-2):47-54.  [Content Brief]