1. GPCR/G Protein
  2. GCGR
  3. GLP-1(9-36)amide

GLP-1(9-36)amide 

Cat. No.: HY-P1141 Purity: 99.78%
COA Handling Instructions

GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor.

For research use only. We do not sell to patients.

GLP-1(9-36)amide Chemical Structure

GLP-1(9-36)amide Chemical Structure

CAS No. : 161748-29-4

Size Price Stock Quantity
1 mg USD 132 In-stock
Estimated Time of Arrival: December 31
5 mg USD 385 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of GLP-1(9-36)amide:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor[1][2].

In Vitro

GLP-1(9-36)amide potently inhibits hepatic glucose production (HGP) and is a weak insulinotropic agent[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3089.41

Appearance

Solid

Formula

C140H214N36O43

CAS No.
Sequence

Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Sequence Shortening

EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

SMILES

[EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : ≥ 25 mg/mL (8.09 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3237 mL 1.6184 mL 3.2369 mL
5 mM 0.0647 mL 0.3237 mL 0.6474 mL
10 mM --- --- ---
*Please refer to the solubility information to select the appropriate solvent.
Purity & Documentation

Purity: 99.78%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(9-36)amide
Cat. No.:
HY-P1141
Quantity:
MCE Japan Authorized Agent: