Insulin glargine

Name: Insulin glargine
Brand: MedChemExpress
SKU: HY-108719
Rating: 4.5 (1 reviews)

Cat. No.: HY-108719 Pureza: ≥95.0%: Ficha de datos
COA

SDS
Instrucciones de manejo
FAQs
Technical Support

Insulin glargine is a long-acting insulin analog. Insulin glargine has the effect of lowering blood sugar and can be used in the research of diabetes. In addition, high doses of Insulin glargine can promote the proliferation of bladder cancer cells.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

Insulin glargine Estructura química

No. CAS : 160337-95-1

Tamaño	Precio	Stock	Cantidad
100 U		En stock	Estimated Time of Arrival: December 31
300 U		En stock	Estimated Time of Arrival: December 31

or Consulta para venta a granel

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Revisión del cliente

Based on 1 publication(s) in Google Scholar

Other Forms of Insulin glargine:

Insulin glargine (Standard) Obtener un presupuesto

1 Publications Citing Use of MCE Insulin glargine

•Anal Chem. 2025 May 13;97(18):9827-9835. [Abstract]

Recomendaciones destacadas

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Ver todos los productos específicos de isoformas Akt:

Ver todas las isoformas

Akt Akt1 Akt2 Akt3

Actividad biológica
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn

In Vitro

Insulin glargine (10-100 IU/L; 0-72 h) activates Akt in a PI3K-independent manner, thereby promoting the proliferation of bladder cancer cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay^[1]

Cell Line:	T24 bladder cancer cell
Concentration:	0.1, 1, 10 and 100 IU/L
Incubation Time:	72 h
Result:	Promoted T24 cell proliferation at concentrations of 10 IU/L and 100 IU/L. Did not affect cell proliferation at 0.1 IU/L and 1 IU/L.

In Vivo

Insulin glargine (2-12.5 IU/kg; subcutaneous injection; 3-12 months) does not present a carcinogenic risk in rodents^[2].
Insulin glargine (450 mg/kg; subcutaneous injection; 6 months) has an improving effect in a mouse model of diabetes^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Seven-week-old male db/db mice^[3]
Dosage:	450 mg/kg
Administration:	Subcutaneous injection (s.c.); 6 months
Result:	Significantly improved glucose tolerance. Upregulated pancreatic β-cell functional genes, such as INS1, Pdx1, Pax4 and Pax6.

Ensayo clínico

Peso molecular

6062.89

Fòrmula

C₂₆₇H₄₀₄N₇₂O₇₈S₆

No. CAS

160337-95-1

Appearance

Liquid

Color

Colorless to light yellow

Sequence

A-chain: Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Gly; B-chain: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)

Sequence Shortening

A-chain: GIVEQCCTSICSLYQLENYCG; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Store at 4°C, do not freeze

Pureza y Documentación

Purity: 95.00%

Select Batch:

Ficha de datos (266 KB) SDS (419 KB)

COA (288 KB)

Instrucciones de manejo (2659 KB)

Referencias

[1]. Liu S, et al. High dose human insulin and insulin glargine promote T24 bladder cancer cell proliferation via PI3K-independent activation of Akt. Diabetes Res Clin Pract. 2011 Feb;91(2):177-82. [Content Brief]

[2]. Stammberger I, et al. Evaluation of the carcinogenic potential of insulin glargine (LANTUS) in rats and mice. Int J Toxicol. 2002 May-Jun;21(3):171-9. [Content Brief]

[3]. Li Y, et al. Comparative Study of Liraglutide and Insulin Glargine on Glycemic Control and Pancreatic β-Cell Function in db/db Mice. Med Sci Monit. 2018 May 19;24:3293-3300. [Content Brief]

[4]. Hwang HG, et al. Recombinant Glargine Insulin Production Process Using Escherichia coli. J Microbiol Biotechnol. 2016;26(10):1781-1789. [Content Brief]