1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Rat (HEK293, Fc)

CD47 Protein, Rat (HEK293, Fc)

Cat. No.: HY-P75402
COA Handling Instructions

CD47 protein, acting as a receptor for THBS1 and modulating integrin signaling, facilitates cell-to-cell interactions. It plays roles in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, immunoregulation, and memory formation. CD47 interacts with SIRPA, SIRPG, FAS/CD95, UBQLN1, UBQLN2, and fibrinogen, enhancing adhesion, T-cell proliferation, and activation. It suppresses angiogenesis, regulates wound healing and stem cell self-renewal, and prevents premature elimination of red blood cells. CD47 influences pulmonary endothelin signaling, NO signaling, and blood pressure regulation. It may also contribute to metabolic dysregulation during aging. CD47 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD47 protein, expressed by HEK293, with C-hFc labeled tag. The total length of CD47 Protein, Rat (HEK293, Fc) is 122 a.a., with molecular weight of 50-70 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
500 μg $785 Get quote
1 mg $1330 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD47 protein, acting as a receptor for THBS1 and modulating integrin signaling, facilitates cell-to-cell interactions. It plays roles in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, immunoregulation, and memory formation. CD47 interacts with SIRPA, SIRPG, FAS/CD95, UBQLN1, UBQLN2, and fibrinogen, enhancing adhesion, T-cell proliferation, and activation. It suppresses angiogenesis, regulates wound healing and stem cell self-renewal, and prevents premature elimination of red blood cells. CD47 influences pulmonary endothelin signaling, NO signaling, and blood pressure regulation. It may also contribute to metabolic dysregulation during aging. CD47 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD47 protein, expressed by HEK293, with C-hFc labeled tag. The total length of CD47 Protein, Rat (HEK293, Fc) is 122 a.a., with molecular weight of 50-70 kDa.

Background

The CD47 protein is an adhesive protein that facilitates cell-to-cell interactions. It acts as a receptor for thrombospondin THBS1 and modulates integrin signaling through the activation of heterotrimeric G proteins. CD47 is involved in various biological processes, including signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. It also plays a role in modulating pulmonary endothelin EDN1 signaling and nitrous oxide (NO) signaling, contributing to blood pressure regulation. Additionally, CD47 is important for memory formation and synaptic plasticity in the hippocampus. It serves as a receptor for SIRPA, preventing maturation of immature dendritic cells and inhibiting cytokine production by mature dendritic cells. Interaction with SIRPG enhances cell-cell adhesion, T-cell proliferation, and T-cell activation. CD47 positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis. It may also be involved in metabolic dysregulation during normal aging and regulate wound healing and stem cell self-renewal. CD47 may play a role in membrane transport, integrin-dependent signal transduction, and prevention of premature elimination of red blood cells. It interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and fibrinogen.

Biological Activity

1.Immobilized Mouse SIRP alpha, His Tag at 2 μg/mL (100μl/well) on the plate. Dose response curve for Rat CD47, hFc Tag with the EC50 of 88.7 ng/mL determined by ELISA.
2.Measured by its binding ability in a functional ELISA. Immobilized Rat CD47 at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse SIRP alpha. The ED50 for this effect is 0.387 μg/mL.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P97829 (Q19-K140)

Gene ID

29364  [NCBI]

Molecular Construction
N-term
CD47 (Q19-K140)
Accession # P97829
hFc
C-term
Synonyms
Leukocyte Surface Antigen CD47; IAP; CD47; MER6
AA Sequence

QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK

Molecular Weight

50-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75402
Quantity:
MCE Japan Authorized Agent: