CD47 Protein, Human (HEK293)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (HEK293) is the recombinant human-derived CD47 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (HEK293) is the recombinant human-derived CD47 protein, expressed by HEK293 , with tag free.

Background

CD47, an adhesive protein, facilitates cell-to-cell interactions and serves as a receptor for thrombospondin THBS1, modulating integrin signaling through the activation of heterotrimeric G proteins. Involved in diverse cellular processes, CD47 contributes to signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. Notably, it plays a role in modulating pulmonary endothelin EDN1 signaling and functions as a pressor agent in the regulation of blood pressure in response to THBS1. CD47 is crucial for memory formation and synaptic plasticity in the hippocampus, acting as a receptor for SIRPA and SIRPG, which impacts dendritic cell maturation, cytokine production, cell-cell adhesion, and T-cell activation. Furthermore, CD47 positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, contributing to metabolic dysregulation during aging. In response to THBS1, CD47 negatively modulates wound healing, inhibits stem cell self-renewal, and may play a role in membrane transport and/or integrin-dependent signal transduction. As a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and potentially fibrinogen, highlighting its intricate involvement in cellular and molecular pathways.

Verified Bioactivity

Immobilized Human CD47 at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Human SIRP alpha, hFc Tag with the EC50 of < 2.0 μg/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD47 (Q19-P139)
      Accession # Q08722
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3; CD47 Antigen; CD47 Antigen (Rh-Related Antigen, Integrin-Associated Signal Transducer); Protein MER6; CD47 Molecule; Integrin Associated Protein

  • AA Sequence

    QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 35-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00