CD47 Protein, Mouse (HEK293, solution)

Customer Review

Based on 1 Customer Validation

The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293, solution) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293, solution) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.

Background

CD47, also known as integrin-associated protein (IAP), is a transmembrane protein encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins and ligands platelet reactive protein-1 (TSP-1) and signal regulatory protein α (SIRPα). CD47 is involved in a variety of biological processes, including signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, and immune regulation. In addition, CD47 is also important in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it prevents immature dendritic cells from maturing and inhibits the production of cytokines by mature dendritic cells. Interaction with SIRPG enhances cell-cell adhesion, T-cell proliferation, and T-cell activation. CD47 positively regulates FAS-dependent T cell apoptosis and inhibits angiogenesis. It may also be involved in metabolic dysregulation during normal aging, regulating wound healing and stem cell self-renewal. CD47 may play a role in cell membrane transport, integrin-dependent signal transduction, and prevention of premature clearance of red blood cells. It interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and fibrinogen. Activation of the CD47 receptor induces the proliferation of human astrocytoma cells through an AKt-dependent pathway. CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis[1][2][3].

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD47 (Q19-K140)
      Accession # Q61735-1/ADQ12919.1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3; CD47 Antigen; CD47 Antigen (Rh-Related Antigen, Integrin-Associated Signal Transducer); Protein MER6; CD47 Molecule; Integrin Associated Protein

  • AA Sequence

    QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

  • Predicted Molecular Mass

    13.8 kDa

  • Molecular Weight

    Approximately 33-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00