CD47 Protein, Mouse (HEK293, solution)
Based on 1 Customer Validation
The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293, solution) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293, solution) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.
Background
CD47, also known as integrin-associated protein (IAP), is a transmembrane protein encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins and ligands platelet reactive protein-1 (TSP-1) and signal regulatory protein α (SIRPα). CD47 is involved in a variety of biological processes, including signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, and immune regulation. In addition, CD47 is also important in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it prevents immature dendritic cells from maturing and inhibits the production of cytokines by mature dendritic cells. Interaction with SIRPG enhances cell-cell adhesion, T-cell proliferation, and T-cell activation. CD47 positively regulates FAS-dependent T cell apoptosis and inhibits angiogenesis. It may also be involved in metabolic dysregulation during normal aging, regulating wound healing and stem cell self-renewal. CD47 may play a role in cell membrane transport, integrin-dependent signal transduction, and prevention of premature clearance of red blood cells. It interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and fibrinogen. Activation of the CD47 receptor induces the proliferation of human astrocytoma cells through an AKt-dependent pathway. CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis[1][2][3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
Q61735-1/ADQ12919.1 (Q19-K140)
-
Molecular Construction
-
N-term
-
CD47 (Q19-K140)
Accession # Q61735-1/ADQ12919.1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3; CD47 Antigen; CD47 Antigen (Rh-Related Antigen, Integrin-Associated Signal Transducer); Protein MER6; CD47 Molecule; Integrin Associated Protein
-
AA Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
-
Predicted Molecular Mass
13.8 kDa
-
Molecular Weight
Approximately 33-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)