CD47 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD47 protein acts as a THBS1 receptor and regulates integrin signaling, promoting cell-cell interactions. It plays a role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, immune regulation, and memory formation. CD47 Protein, Rat (HEK293, His) is the recombinant rat-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD47 protein acts as a THBS1 receptor and regulates integrin signaling, promoting cell-cell interactions. It plays a role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, immune regulation, and memory formation. CD47 Protein, Rat (HEK293, His) is the recombinant rat-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD47 protein is an adhesive protein that facilitates cell-to-cell interactions. It acts as a receptor for thrombospondin THBS1 and modulates integrin signaling through the activation of heterotrimeric G proteins. CD47 is involved in various biological processes, including signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. It also plays a role in modulating pulmonary endothelin EDN1 signaling and nitrous oxide (NO) signaling, contributing to blood pressure regulation. Additionally, CD47 is important for memory formation and synaptic plasticity in the hippocampus. It serves as a receptor for SIRPA, preventing maturation of immature dendritic cells and inhibiting cytokine production by mature dendritic cells. Interaction with SIRPG enhances cell-cell adhesion, T-cell proliferation, and T-cell activation. CD47 positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis. It may also be involved in metabolic dysregulation during normal aging and regulate wound healing and stem cell self-renewal. CD47 may play a role in membrane transport, integrin-dependent signal transduction, and prevention of premature elimination of red blood cells. It interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and fibrinogen.

Verified Bioactivity

Immobilized Mouse SIRP alpha, Mouse at 10 μg/mL (100 μL/well) can bind Rat CD47 with a linear range of 117.2 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD47 (Q19-K140)
      Accession # P97829-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3

  • AA Sequence

    QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK

  • Molecular Weight

    Approximately 27-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00