CD47 Protein, Human (Biotinylated, HEK293, Avi-His)

1.Immobilized Biotinylated Human CD47-His at 2 μg/mL (100 μl/well). Dose response curve for Human SIRP alpha-hFc with the EC₅₀ of 0.03 ng/mL determined by ELISA.
2.Immobilized Human SIRP alpha, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose responsecurve for Biotinylated Human CD47, His Tag with the EC₅₀ of< 0.48 μg/mL determined by ELISA

Human

HEK293

C-Avi;C-6*His

Q08722 (Q19-P139)

961  [NCBI]

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

30-55 kDa

Greater than 95% as determined by reducing SDS-PAGE or Tis-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0 or PBS (pH 7.4), normally 5% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.