IFN-beta Protein, Mouse (HEK293)

IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS). IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free.

IFN-beta belongs to the type I interferon family^[2][3][7]. IFN-beta is a secreted cytokine produced by cells in response to viral infection or nucleic acid stimulation^[2][5][7]. IFN-beta binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS)^[2][3][4][7]. IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization and reducing the secretion of pro-inflammatory cytokines), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects^[2][5][6][7]. IFN-beta is expressed in tissues such as the spleen, lungs, and kidneys, as well as in vascular endothelial cells and immune cells^[5][7]. IFN-beta Protein, Mouse has 50% sequence identity to human IFN-beta^[8].

IFN-beta Protein, Mouse (10000 IU/mouse; i.p.; daily; 5 days) enhances DHPG (HY-12598A)-mediated protection against HSV-2 systemic infection in Swiss Webster mice, reducing mortality^[6].
IFN-beta Protein, Mouse (10 MIU/kg; s.c.; daily; 4 weeks) attenuates Ang II-induced atherosclerotic plaque formation in apoE^-/- mice, reducing lesion area in carotid artery by 30%^[7].

1. Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED₅₀ is 3-18 pg/mL.
2. Determined by a cytotoxicity assay using human TF-1 cells. The ED₅₀ this effect is ≤0.3901 ng/mL, corresponding to a specific activity is ≥2.563×10⁶ units/mg.
3. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse IFNAR2 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse IFN-beta. The ED₅₀ for this effect is <5 ng/mL.

• 
  Determined by a cytotoxicity assay using human TF-1 cells. The ED₅₀ for this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×10⁶ units/mg.

Mouse

HEK293

Tag Free

P01575 (I22-N182)

15977  [NCBI]

Full Length of Mature Protein

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Approximately 24-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jeannin S, et al. Response to interferon-Beta treatment in afro-caribbeans with multiple sclerosis. Mult Scler Int. 2011;2011:950126.  [Content Brief]

  [2]. Stübgen JP. Recombinant interferon-beta therapy and neuromuscular disorders. J Neuroimmunol. 2009 Jul 25;212(1-2):132-41.  [Content Brief]

  [3]. Abraham A K, et al. Mechanisms of interferon-β effects on bone homeostasis. Biochemical pharmacology, 2009, 77(12): 1757-1762.

  [4]. Yeung VP, et al. Elimination of an immunodominant CD4+ T cell epitope in human IFN-beta does not result in an in vivo response directed at the subdominant epitope. J Immunol. 2004 Jun 1;172(11):6658-65.  [Content Brief]

  [5]. Singh R, et al. Cell density-dependent modulation of basic fibroblast growth factor expression by human interferon-beta. Int J Oncol. 1996 Apr;8(4):649-56.  [Content Brief]

  [6]. Fraser-Smith EB, et al. Enhanced efficacy of the acyclic nucleoside 9-(1,3-dihydroxy-2-propoxymethyl)guanine in combination with beta-interferon against herpes simplex virus type 2 in mice. Antimicrob Agents Chemother. 1984 May;25(5):563-5.  [Content Brief]

  [7]. Zhang LN, et al. Interferon-beta attenuates angiotensin II-accelerated atherosclerosis and vascular remodeling in apolipoprotein E deficient mice. Atherosclerosis. 2008 Mar;197(1):204-11.  [Content Brief]

  [8]. Karpusas M, et al. The crystal structure of human interferon beta at 2.2-A resolution. Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11813-8.  [Content Brief]