Copy Link Print Information

IFN-beta Protein, Human (CHO)

6 Cited Publications
Customer Review

Based on 6 publication(s) in Google Scholar

IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS). IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. IFN-beta Protein, Human (CHO) is a recombinant interferon-beta protein (CHO), expressed by CHO, without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • IFN-beta Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS). IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. IFN-beta Protein, Human (CHO) is a recombinant interferon-beta protein (CHO), expressed by CHO, without a tag.

Background

IFN-beta belongs to the type I interferon family[2][3][7]. IFN-beta is a secreted cytokine produced by cells in response to viral infection or nucleic acid stimulation[2][5][7]. IFN-beta binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS)[2][3][4][7]. IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization and reducing the secretion of pro-inflammatory cytokines), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects[2][5][6][7]. IFN-beta is expressed in tissues such as the spleen, lungs, and kidneys, as well as in vascular endothelial cells and immune cells[5][7]. IFN-beta, Human is a 166-amino acid protein with 35% sequence identity to the consensus sequence of IFN-α and 50% sequence identity to murine IFN-β (muIFN-β)[8].

In Vitro

IFN-beta Protein, Human (10 U/mL; 48-96 h) inhibits bFGF mRNA and protein expression in a cell density-dependent manner in human renal cell carcinoma SN12PM6 cells[5].

In Vivo

IFN-beta Protein, Human (25 μg; i.p.; 3 times; days 1, 3, and 10) induces T cell proliferative responses to human IFNβ in BALB/cByJ mice[4].

Verified Bioactivity

1.Measured in antiviral assays using WISH cells infected with vesicular stomatitis virus and the ED50 is 1-20 pg/mL.
2.Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is <0.1 ng/mL, corresponding to a specific activity of >1 x 107 units/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P01574 (M22-N187)

  • Gene ID
    3456  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-beta (M22-N187)
      Accession # P01574
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNB1; IFF; Prev. IFNB; Fibroblast Interferon; IFB; IFN-Beta; Interferon Beta; Interferon-Beta; Interferon Beta 1; Interferon, Beta 1, Fibroblast

  • AA Sequence

    MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1. Lyophilized from a 0.22 μm filtered solution of acetate buffer solution 5% trehalose, 5% mannitol, 0.01% Tween-80.
2. Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3. Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4. Lyophilized from a 0.22 μm filtered solution of 40 mM Arg, 0.12 mg/ml DL-Methionine, 146 mg/ml sucrose, 0.1% PF68, pH 4.5, 5% trehalose, 5% mannitol, 0.01% Tween-80.
5. Lyophilized from a 0.22 μm filtered solution of 10 mM NaAC, 40 mM Arg, 0.12 mg/ml DL-Methionine, 146 mg/ml sucrose, 0.1% PF68, pH 4.5, 5% trehalose, 5% mannitol, 0.01% Tween-80 .
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jeannin S, et al. Response to interferon-Beta treatment in afro-caribbeans with multiple sclerosis. Mult Scler Int. 2011;2011:950126. [Content Brief]

[2]. Stübgen JP. Recombinant interferon-beta therapy and neuromuscular disorders. J Neuroimmunol. 2009 Jul 25;212(1-2):132-41. [Content Brief]

[3]. Abraham A K, et al. Mechanisms of interferon-β effects on bone homeostasis. Biochemical pharmacology, 2009, 77(12): 1757-1762.

[4]. Yeung VP, et al. Elimination of an immunodominant CD4+ T cell epitope in human IFN-beta does not result in an in vivo response directed at the subdominant epitope. J Immunol. 2004 Jun 1;172(11):6658-65. [Content Brief]

[5]. Singh R, et al. Cell density-dependent modulation of basic fibroblast growth factor expression by human interferon-beta. Int J Oncol. 1996 Apr;8(4):649-56. [Content Brief]

[6]. Fraser-Smith EB, et al. Enhanced efficacy of the acyclic nucleoside 9-(1,3-dihydroxy-2-propoxymethyl)guanine in combination with beta-interferon against herpes simplex virus type 2 in mice. Antimicrob Agents Chemother. 1984 May;25(5):563-5. [Content Brief]

[7]. Zhang LN, et al. Interferon-beta attenuates angiotensin II-accelerated atherosclerosis and vascular remodeling in apolipoprotein E deficient mice. Atherosclerosis. 2008 Mar;197(1):204-11. [Content Brief]

[8]. Karpusas M, et al. The crystal structure of human interferon beta at 2.2-A resolution. Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11813-8. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is 0.07167 ng/mL, corresponding to a specific activity of 1.395 x 107 units/mg.

  • 1/16

    IFN-beta Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Aug 28:161:115059. [Abstract]

    Customer Validation
     HPCs were treated with IFN-β1(IFN-β, 1 ng/ml) for 24 h. Representative western blot images and quantitation of Podocin and WT1.

  • 1/16

    IFN-beta Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Aug 28:161:115059. [Abstract]

    Customer Validation
     Representative western blot images and quantitation of HERC5 treated with IFN-β (1 ng/ml) for 15 min, 30 min, 60 min, 120 min, 240 min.

  • 1/16

    IFN-beta Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Aug 28:161:115059. [Abstract]

    Customer Validation
     Real time qPCR showing mRNA levels of Ifn-b1, Tnf-α, Il-6, Cxcl10 and Il-10 treated with IFN-β (1 ng/ml) for 30 min. GAPDH was used for normalization. n = 3 independent experiments.

  • 1/16

    IFN-beta Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Aug 28:161:115059. [Abstract]

    Customer Validation
     The localization and expression of p-IRF3 (Ser385) and p-IRF3 (Ser396) in HPCs was detected by IF treated with IFN-β (1 ng/ml) for 30 min

  • 1/16

    IFN-beta Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Aug 28:161:115059. [Abstract]

    Customer Validation
     Representative western blot images and quantitation of HERC5, p-IRF3 (Ser385), p-IRF3 (Ser396) and total IRF3 levels in HPCs pretreated with NC and siHERC5 and treated with IFN-β (1 ng/ml) for 30 min.

  • IFN-beta Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • Experimental Validation Results for IFN-beta Protein, Human (CHO)
  • IFN-beta Protein, Human (CHO) Product Image