Copy Link Print Information

IFN-alpha 2a/IFNA2 Protein, Human (R46K)

10 Cited Publications
Customer Review

Based on 10 publication(s) in Google Scholar

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion. IFN-alpha 2a/IFNA2 Protein, Human (C24-E188, R46K) contains 165 a.a., is produced in E. coli with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2a/IFNA2 Protein, Human (C24-E188, R46K) contains 165 a.a., is produced in E. coli with tag free.

Background

IFN-alpha 2 (IFNA2; IFN-α2), belongs to the type I interferon family, produced by the plasmacytoid dendritic cells (pDCs) exposure to HIV-1BaL in order to inhibit viral infection[1].
Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
IFN-alpha 2 subtype is the only one that is currently licensed to treat infections caused by hepatitis B virus (HBV) and HCV[3].
IFN-alpha 2 shows a Sortilin-dependent trafficking in cells and increases the expression level of interferon-stimulated genes (ISGs) in HIV-infected cells[1][4]. It also exhibits cytotoxic activity against CD8+ T cells and enhances CD4+ T cell depletion[3].
Among the IFN-alpha 2 alleles, IFN-alpha 2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant[5].
IFN-alpha 2 has a bored application in research of cancer, including some hematological malignancies and solid tumors[6]. As for a wildly use of IFN in animal disease model, the sequence of amino acids in IFNA2a protein of human is very different from mouse (59.57%).

In Vivo

IFNA2a (hydrodynamic injection with plasmids) leads to upregulation of interferon-stimulated genes (ISGs) and results HIV-1 induced CD4+ T cell depletion in the hu-PBL humanized mouse model[3].

Verified Bioactivity

The ED50 is ≤0.5005 ng/mL as measured by TF-1 cells, corresponding to a specific activity of ≥1.998 × 106 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01563 (C24-E188, R46K)

  • Gene ID
    3440  [NCBI]
  • Molecular Construction
    • N-term
    • IFNA2 (C24-E188, R46K)
      Accession # P01563
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNA2; IFN-Alpha-2; Interferon Alpha 2; IFNA2B; IFN-AlphaA; LeIF A; IFNA; Interferon Alpha 2a; Alpha-2a Interferon; Interferon Alpha-A; Interferon Alpha 2b; Interferon 1AB4; Interferon Alpha A; IFNA2C; Interferon Alpha-2; IFNA2A

  • AA Sequence

    CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7(48):78412-78420. [Content Brief]

[2]. Gerasymenko IM, et al. MULTIPLEX PCR ASSAY FOR DETECTION OF HUMAN SOMATOTROPIN AND INTERFERON ALPHA2b GENES IN PLANT MATERIAL. Tsitol Genet. 2015 May-Jun;49(3):3-8. [Content Brief]

[3]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]

[4]. Chang CH, et al. A new method to produce monoPEGylated dimeric cytokines shown with human interferon-α2b. Bioconjug Chem. 2009 Oct 21;20(10):1899-907. [Content Brief]

[5]. Sutter K, et al. Interferon α subtypes in HIV infection. Cytokine Growth Factor Rev. 2018 Apr;40:13-18. [Content Brief]

[6]. Watanabe H, et al. Detailed structure of mouse interferon α2 and its interaction with Sortilin. J Biochem. 2021 Oct 11;170(2):265-273. [Content Brief]

[7]. Gull I, et al. Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b. Springerplus. 2013 Jun 15;2(1):264. [Content Brief]

[8]. Paul F, et al. IFNA2: The prototypic human alpha interferon. Gene. 2015 Aug 10;567(2):132-7. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by a cytotoxicity assay using TF-1 Cells. The ED50 for this effect is 0.1509 ng/mL, corresponding to a specific activity is 6.627 ×106units/mg.

  • 1/16

    IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Dec 10:167:115741. [Abstract]

    Customer Validation
     Trans-cinnamaldehyde (TCA) attenuated IFN-alpha 2a/IFNA2 Protein (IFN-α, HY-P7022, 8000 IU/g; s.c.; once daily for 10 days)-induced depressive-like behaviors in the FST, TST and SPT (n = 10). Compared with controls, IFN-α treatment significantly increased immobility time in both the FST and TST (P < 0.001) and diminished sucrose preference in the SPT (P < 0.001), indicative of behavioral despair and anhedonia.

  • 1/16

    IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Dec 10:167:115741. [Abstract]

    Customer Validation
     Representative fluorescence image of astrocytic Cx43 (red), astrocytes (green), and their overlap. Immunofluorescence analysis of astrocytic Cx43 (co-labeled with GFAP) revealed that IFN-alpha 2a/IFNA2 Protein (IFN-α, HY-P7022, 8000 IU/g; s.c.; once daily for 10 days) treatment substantially decreased Cx43 expression (P < 0.001), while TCA administration reversed this deficit (P < 0.001).

  • 1/16

    IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Dec 10:167:115741. [Abstract]

    Customer Validation
     IFN-alpha 2a/IFNA2 Protein (IFN-α, HY-P7022, 8000 IU/g; s.c.; once daily for 10 days). Representative blots of Cx43 and its phosphorylated forms at Y265 and S368. TCA-10, TCA-20 and TCA-40 represents TCA doses of 10 mg/kg, 20 mg/kg and 40 mg/kg, while Cele-10 represents Celecoxib at 10 mg/kg.

  • 1/16

    IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Lupus Sci Med. 2025 Jun 19;12(1):e001407. [Abstract]

    Customer Validation
     MerTK expression on NK cells from SLE and healthy PBMCs in response to IFN-alpha 2a/IFNA2 Protein (IFNα, 500 ng/mL, HY-P7022) after 12 hours, 24 hours and 48 hours (paired t-test).

  • 1/16

    IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: JHEP Rep. 2023 Jul 15;5(10):100849. [Abstract]

    Customer Validation
     The protein levels of HBx were reduced in HBV-infected HepG2-NTCP cells after 5C-8-HQ (20 μM, HY-12304) and IFN-alpha 2a/IFNA2 Protein (IFNα, 20 ng/mL, HY-P7022) treatment, respectively, as measured by western blotting.

  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) Product Image
    1/16
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • Experimental Validation Results for IFN-alpha 2a/IFNA2 Protein, Human (R46K)
  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) Product Image

  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Dec 10:167:115741. [Abstract]

    Trans-cinnamaldehyde (TCA) attenuated IFN-alpha 2a/IFNA2 Protein (IFN-α, HY-P7022, 8000 IU/g; s.c.; once daily for 10 days)-induced depressive-like behaviors in the FST, TST and SPT (n = 10). Compared with controls, IFN-α treatment significantly increased immobility time in both the FST and TST (P < 0.001) and diminished sucrose preference in the SPT (P < 0.001), indicative of behavioral despair and anhedonia.

  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Dec 10:167:115741. [Abstract]

    Representative fluorescence image of astrocytic Cx43 (red), astrocytes (green), and their overlap. Immunofluorescence analysis of astrocytic Cx43 (co-labeled with GFAP) revealed that IFN-alpha 2a/IFNA2 Protein (IFN-α, HY-P7022, 8000 IU/g; s.c.; once daily for 10 days) treatment substantially decreased Cx43 expression (P < 0.001), while TCA administration reversed this deficit (P < 0.001).

  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Dec 10:167:115741. [Abstract]

    IFN-alpha 2a/IFNA2 Protein (IFN-α, HY-P7022, 8000 IU/g; s.c.; once daily for 10 days). Representative blots of Cx43 and its phosphorylated forms at Y265 and S368. TCA-10, TCA-20 and TCA-40 represents TCA doses of 10 mg/kg, 20 mg/kg and 40 mg/kg, while Cele-10 represents Celecoxib at 10 mg/kg.

  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: Lupus Sci Med. 2025 Jun 19;12(1):e001407. [Abstract]

    MerTK expression on NK cells from SLE and healthy PBMCs in response to IFN-alpha 2a/IFNA2 Protein (IFNα, 500 ng/mL, HY-P7022) after 12 hours, 24 hours and 48 hours (paired t-test).

  • IFN-alpha 2a/IFNA2 Protein, Human (R46K) purchased from MedChemExpress. Usage Cited in: JHEP Rep. 2023 Jul 15;5(10):100849. [Abstract]

    The protein levels of HBx were reduced in HBV-infected HepG2-NTCP cells after 5C-8-HQ (20 μM, HY-12304) and IFN-alpha 2a/IFNA2 Protein (IFNα, 20 ng/mL, HY-P7022) treatment, respectively, as measured by western blotting.