1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-beta
  5. IFN-beta Protein, Human (HEK293)

IFN-beta Protein, Human (HEK293)

Cat. No.: HY-P7024
Handling Instructions

IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $200 Get quote
50 μg $560 Get quote
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model[3].

Background

Interferon-beta is a cytokine with immunomodulatory properties, and has therapeutic potential for the treatment of ischemic stroke[1]. Interferon-beta (IFN-β) suppresses the production of IFN-γ and induces IL-10, whereas the production of IL-4 is not altered[2].

Biological Activity
The ED50 is <0.1 ng/mL as measured by TF-1 cells.
Species

Human

Source

HEK293

Accession

P01574 (M22-N187)

Gene ID
Synonyms
rHuIFN-β; IFNB
AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Molecular Weight

Approximately 23 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-beta Protein, Human (HEK293) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-beta Protein, Human (HEK293)
Cat. No.:
HY-P7024
Quantity:
MCE Japan Authorized Agent: