Copy Link Print Information

IFN-beta Protein, Human (HEK293, Fc)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IFN-β (interferon-β) is a key type I interferon cytokine that coordinates the innate immune response to infection, tumors, and inflammation. IFN-β binds to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptors, activates Jak-STAT signaling, and modulates interferon-regulated genes. IFN-beta Protein, Human (HEK293, Fc) is the recombinant human-derived IFN-beta protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for IFN-beta Protein, Human (HEK293, Fc)
  • Experimental Validation Results for IFN-beta Protein, Human (HEK293, Fc)
  • IFN-beta Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-β (interferon-β) is a key type I interferon cytokine that coordinates the innate immune response to infection, tumors, and inflammation. IFN-β binds to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptors, activates Jak-STAT signaling, and modulates interferon-regulated genes. IFN-beta Protein, Human (HEK293, Fc) is the recombinant human-derived IFN-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IFN-beta (Interferon-beta), a pivotal type I interferon cytokine, assumes a critical role in orchestrating the innate immune response to various challenges, including infections, tumor development, and inflammatory stimuli. Acting through a high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, IFN-beta triggers the canonical Jak-STAT signaling pathway, leading to the transcriptional activation or repression of interferon-regulated genes. These genes, in turn, encode effectors crucial for the interferon response, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While primarily signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta also demonstrates versatility by functioning with IFNAR1 alone and operating independently of Jak-STAT pathways. Its multifaceted effects span antiviral and antibacterial activities, modulation of B-cell development, myelopoiesis, and lipopolysaccharide-inducible production of tumor necrosis factor. In the realm of neuronal homeostasis, IFN-beta emerges as a guardian, regulating dopamine turnover and safeguarding dopaminergic neurons through the promotion of neuronal autophagy and alpha-synuclein clearance, thereby averting dopaminergic neuron loss. Notably, IFN-beta surpasses interferon-alpha (IFN-alpha) in potency, particularly in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. Presenting as a monomer, IFN-beta embodies a versatile and potent player in diverse physiological responses and immune regulation.

Verified Bioactivity

Measured in antiviral assays using WISH human amnion cells infected with vesicular stomatitis virus (VSV) and the ED50 is 0.08-0.8 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    P01574 (M22-N187)

  • Gene ID
    3456  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-beta (M22-N187)
      Accession # P01574
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNB1; IFF; Prev. IFNB; Fibroblast Interferon; IFB; IFN-Beta; Interferon Beta; Interferon-Beta; Interferon Beta 1; Interferon, Beta 1, Fibroblast

  • AA Sequence

    MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

  • Predicted Molecular Mass

    46.7 kDa

  • Molecular Weight

    Approximately 52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 10% trehalose, 0.02% Tween 80, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    IFN-beta Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Immunity. 2025 Nov 11;58(11):2670-2684.e10. [Abstract]

    Customer Validation
     L929 cells, iBMDM cells, and HEK293T cells were stimulated with IFN-β (1-5 ng/mL; 3-12 h) for the indicated time points. The expression levels of SMPDL3B were detected by immunoblotting.

  • 1/16

    IFN-beta Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Cell Rep. 2023 Oct 16;42(10):113261. [Abstract]

    Customer Validation
     Inhibition of V. parahaemolyticus invasion in the presence of IFN-β. Caco-2 cells were pretreated with or without IFN-β (100 U/mL) for 24 h and then were infected with indicated strains at an MOI of 50 for 2 h. The intracellular bacteria were counted by spreading the cell lysates on agar plates to determine the bacterial invasion.

  • IFN-beta Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for IFN-beta Protein, Human (HEK293, Fc)
  • Experimental Validation Results for IFN-beta Protein, Human (HEK293, Fc)
  • IFN-beta Protein, Human (HEK293, Fc) Product Image

  • IFN-beta Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Immunity. 2025 Nov 11;58(11):2670-2684.e10. [Abstract]

    L929 cells, iBMDM cells, and HEK293T cells were stimulated with IFN-β (1-5 ng/mL; 3-12 h) for the indicated time points. The expression levels of SMPDL3B were detected by immunoblotting.

  • IFN-beta Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Cell Rep. 2023 Oct 16;42(10):113261. [Abstract]

    Inhibition of V. parahaemolyticus invasion in the presence of IFN-β. Caco-2 cells were pretreated with or without IFN-β (100 U/mL) for 24 h and then were infected with indicated strains at an MOI of 50 for 2 h. The intracellular bacteria were counted by spreading the cell lysates on agar plates to determine the bacterial invasion.