1. Recombinant Proteins
  2. IL-36 gamma/IL-1F9 Protein, Human (152a.a)

IL-36 gamma/IL-1F9 Protein, Human (152a.a)

Cat. No.: HY-P70670
Handling Instructions

IL-36 gamma/IL-1F9 Protein, Human (152a.a) is proinflammatory and have an important role in innate and adaptive immunity.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $330 Ask For Quote & Lead Time
50 μg $990 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
IL-36 gamma; IL-36γ; Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1
Species

Human

Source

E. coli

Accession

Q9NZH8 (S18-D169)

Gene ID

56300

Molecular Weight

14-16 kDa

AA Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
The ability to induce IL-8 secretion in A431 human epithelial carcinoma cells has an ED50 value of 5-20 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 100 mM NaCl, 0.1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

The IL-36 group of cytokines comprises three pro-inflammatory agonists (IL-36α, IL-36β, and IL-36γ), and one antagonist (IL-36Ra). All members of the IL-36 family use the same receptor (IL-36R), a heterodimer composed of interleukin-1 receptor-like 2 (IL1RL2) as the ligand binding moiety and the IL-1 receptor accessory protein (IL1RAcP). This receptor induces inflammatory responses through MyD88, MAPK, NF-kB, and AP-1 pathways. Constitutive protein expression of IL-36 (α, β, and γ) and their receptor (IL-36R) was found in all cell types. IL-36 cytokines are modulated by microbial components and regulate trophoblast migration and interaction with endothelial cells[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 gamma/IL-1F9 Protein, Human (152a.a)
Cat. No.:
HY-P70670
Quantity:
MCE Japan Authorized Agent: