1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 gamma
  6. IL-36 gamma/IL-1F9 Protein, Human (152a.a)

IL-36 gamma/IL-1F9 Protein, Human (152a.a)

Cat. No.: HY-P70670
COA Handling Instructions

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 gamma/IL-1F9 Protein, Human (152a.a) is a recombinant human IL-36 gamma (S18-D169) without any tag, which is produced in E. coli.

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $220 In-stock
50 μg $620 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 gamma/IL-1F9 Protein, Human (152a.a) is a recombinant human IL-36 gamma (S18-D169) without any tag, which is produced in E. coli.

Background

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma is expressed in peripheral blood lymphocytes, keratinocytes, bronchial epithelial cells and THP-1 cells[3].
The sequence of amino acids in IL-36 gamma differs in different species. Human IL-36 gamma shares <55% aa sequence identity with mouse.
IL-36 gamma has β-trefoil structure. L-36 gamma binds to IL-36R and recruits the co-receptor IL-1RAcP. So that heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways[1]. But the activation requires N-terminal cleavage at Val1518 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[1][2]. IL-36 gamma is associated with chronic inflammation and cancers. IL-36 gamma is up-regulated in skin psoriatic lesions, inaganglionic and ganglionic areas of the colon in patients with Hirschsprung's disease, and inflamed mucosa of patients with inflammatory bowel disease (IBD)[1][4].
IL-36 gamma is a pro-inflammatory factor. IL-36 gamma mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[2].

In Vitro

IL-36 gamma (human, 50 ng/mL for 4 h or 100 ng/mL for 24 h) promotes the expression of pro-inflammatory cytokines and antibacterial peptides in NHOKs (oral keratinocytes)[5].
IL-36 gamma (human, 0.1 ng/mL, 3 days) promotes colony formation, migration and invasion of AGS cells[6].

Biological Activity

The ability to induce IL-8 secretion in A431 human epithelial carcinoma cells has an ED50 value of 5-20 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NZH8 (S18-D169)

Gene ID
Synonyms
IL-36 gamma; IL-36γ; Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1
AA Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Molecular Weight

14-16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

IL-36 gamma/IL-1F9 Protein, Human (152a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 gamma/IL-1F9 Protein, Human (152a.a)
Cat. No.:
HY-P70670
Quantity:
MCE Japan Authorized Agent: