1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 gamma
  6. IL-36 gamma/IL-1F9 Protein, Human (His)

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases.IL-36 gamma/IL-1F9 Protein, Human (His) is a recombinant human IL-36 gamma with His tag, which is produced in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2].IL-36 gamma/IL-1F9 Protein, Human (His) is a recombinant human IL-36 gamma with His tag, which is produced in E. coli.

Background

IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma is expressed in peripheral blood lymphocytes, keratinocytes, bronchial epithelial cells and THP-1 cells[3].
The sequence of amino acids in IL-36 gamma differs in different species. Human IL-36 gamma shares <55% aa sequence identity with mouse.
IL-36 gamma has β-trefoil structure. L-36 gamma binds to IL-36R and recruits the co-receptor IL-1RAcP. So that heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways[1]. But the activation requires N-terminal cleavage at Val1518 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[1][2]. IL-36 gamma is associated with chronic inflammation and cancers. IL-36 gamma is up-regulated in skin psoriatic lesions, inaganglionic and ganglionic areas of the colon in patients with Hirschsprung's disease, and inflamed mucosa of patients with inflammatory bowel disease (IBD)[1][4].
IL-36 gamma is a pro-inflammatory factor. IL-36 gamma mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[2].

In Vitro

IL-36 gamma (human, 5 ng/mL for 4 h or 1 ng/mL for 24 h) promots the expression of pro-inflammatory cytokines and antibacterial peptides in NHOKs (oral keratinocytes)[5].
IL-36 gamma (human, .1 ng/mL, 3 days) promotes colony formation, migration and invasion of AGS cells[6].

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9NZH8-1 (S18-D169)

Gene ID
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-36 gamma; IL-36γ; IL36G; IL-1F9; IL-1H1
AA Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Predicted Molecular Mass
19.1 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-36 gamma/IL-1F9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-36 gamma/IL-1F9 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 gamma/IL-1F9 Protein, Human (His)
Cat. No.:
HY-P75861
Quantity:
MCE Japan Authorized Agent: